KEGG   Kytococcus sedentarius: Ksed_13020Help
Entry
Ksed_13020        CDS       T00974                                 

Definition
excinuclease ABC subunit B
Orthology
K03702  
excinuclease ABC subunit B
Organism
kse  Kytococcus sedentarius
Pathway
Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:kse00001]
 Genetic Information Processing
  Replication and repair
   03420 Nucleotide excision repair
    Ksed_13020
DNA repair and recombination proteins [BR:kse03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     Supressor
      Ksed_13020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1346436..1348553
Genome map
AA seq 705 aa AA seqDB search
MRPVTDLQRSVAPFEVVSEYDPAGDQPTAIAELTRRIEAGEQDVVLLGATGTGKSATTAW
MIEKLQRPTLVMAPNKTLAAQLANEFRELLPNNAVEYFVSYYDYYQPEAYVPQSDTYIEK
DSSINEEVERLRHSATNSLLTRRDVVVVASVSCIYGLGTPQEYVDRMVRLHVGQEMDREE
LLRKFVTMQYTRNDMAFQRGTFRVRGDTVEIIPMYEELAVRIEFFGDEIEAVATLNPLTG
EVVRDEQEMYIFPATHYVAGPERMEKAISRIETELEQQLERFEQQGKLLEAQRLRMRTTY
DVEMMREMGSCNGIENYSLHIDGREPGSAPNCLLDYFPEDFLLVLDESHVTVPQIGAMFE
GDMSRKRTLVDHGFRLPSAMDNRPLKWEEFLERIGQTVYLSATPGDYELAKSDGYVEQII
RPTGLVDPEIVVKPTQGQIDDLLAEIRERAERNERVLVTTLTKKMAEDLTDYLLERQVRV
RYLHSEVDTLRRIELLKELRLGEYDVLVGINLLREGLDLPEVSLVSILDADKQGFLRSNR
SLIQTIGRAARNVSGQVHMYADKVTESMQYAIDETNRRRAVQIAHNTEHGIDPTPLRKKI
GDITEMLVEMQGLAGTWEGAEDPGRPTGRRGRAEAQDADVAADLAVATGDRPTDMPRAEL
AQLIQQLSDQMHTAASQLQFELAGRLRDEIADLRKELRQMERAGG
NT seq 2118 nt NT seq  +upstreamnt  +downstreamnt
atgcgccccgtcaccgacctccaacgcagcgtcgctcccttcgaggtggtctccgagtac
gaccccgccggggaccagccgaccgcgatcgccgagctgacccgccgcatcgaggcgggg
gagcaggacgtcgtcctgctgggcgcgaccggtaccggcaagtcggcgaccacggcatgg
atgatcgagaagctgcagcggcccaccctcgtgatggcccccaacaagacgttggccgcc
cagctggccaacgagttccgcgagctgctgccgaacaacgcggtcgagtacttcgtttcg
tactacgactactaccaacccgaggcgtacgtcccccagtcggacacctacatcgagaag
gactcctccatcaacgaggaggtcgagcggctgcggcacagtgccacgaactcgctgctc
acccgacgggacgtggtcgtggtggcgtcggtgtcctgcatctacggcctgggcaccccg
caggagtacgtcgaccgcatggtgcgcctgcacgtggggcaggagatggaccgcgaggag
ctcctgcgcaagttcgtcacgatgcagtacacccgcaacgacatggccttccagcggggc
accttcagagtccggggcgacacggtcgagatcatcccgatgtacgaggagctcgcggtg
cgcatcgagttcttcggcgacgagatcgaggcggtcgccaccctgaacccgctcaccggg
gaggtcgtgcgcgacgagcaggagatgtacatcttcccggccacccactacgtcgccggg
ccggagcgcatggagaaggcgatctcccgcatcgagaccgagctcgagcagcagctcgag
cgcttcgagcagcagggcaagctgctggaggcccagcggctgcgcatgcgcaccacctac
gacgtcgagatgatgcgggagatgggctcgtgcaacggcatcgagaactactcgctgcac
atcgacggacgcgagcccggctcggcgcccaactgcctgctcgactacttccccgaggac
ttcctgctggtgctcgacgagtcccacgtgacggtcccgcagatcggcgccatgttcgag
ggcgacatgtcacgcaagcggaccctggtggaccacggcttccgcctgcccagcgccatg
gacaaccggccgttgaagtgggaggagttcctcgagcgcatcggccagaccgtgtacctg
tcggccacgccgggggactacgagctggcgaagtcggacggctacgtggagcagatcatc
cggcccaccggcctggtggacccggagatcgtcgtcaagcccacgcagggccagatcgac
gacctgctggccgagatccgcgagcgggccgagcgcaacgagcgggtcctggtcaccacg
ctcaccaagaagatggccgaggacctcaccgactacctgctggagcggcaggtgcgcgtg
cgctacctgcacagcgaggtcgacaccctgcgccgcatcgagctgctcaaggagctgcgg
ctgggggaatacgacgttctggtgggcatcaacctgctgcgcgagggcctggacctgccc
gaggtgtcgctcgtgagcatcttggacgcggacaagcagggcttcctgcgttccaaccgg
tccctcatccagaccatcggccgcgcggcccgcaacgtctccggccaggtgcacatgtac
gcggacaaggtcaccgagtccatgcagtacgccatcgacgagaccaaccgccggcgggcg
gttcagatcgcgcacaacaccgagcacggcatcgacccgaccccgctgcgcaagaagatc
ggcgacatcaccgagatgctcgtggagatgcagggcctggccgggacctgggagggcgcc
gaggaccccggacgcccgacgggacgccgggggagggccgaggcccaggacgccgacgtc
gccgccgacctggcggtggccacgggcgaccgcccgaccgacatgcccagggcggagctc
gcccagctcatccagcagctctcggaccagatgcacacggcggccagccagctgcagttc
gagctcgccgggcgcctgcgggacgagatcgccgacctgcgcaaggaactgcggcagatg
gagcgcgccggagggtga

DBGET integrated database retrieval system