KEGG   Kytococcus sedentarius: Ksed_13020Help
Entry
Ksed_13020        CDS       T00974                                 

Definition
excinuclease ABC subunit B
Orthology
K03702  
excinuclease ABC subunit B
Organism
kse  Kytococcus sedentarius
Pathway
Nucleotide excision repair
Class
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:kse03420]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1346436..1348553
Genome map
AA seq 705 aa AA seqDB search
MRPVTDLQRSVAPFEVVSEYDPAGDQPTAIAELTRRIEAGEQDVVLLGATGTGKSATTAW
MIEKLQRPTLVMAPNKTLAAQLANEFRELLPNNAVEYFVSYYDYYQPEAYVPQSDTYIEK
DSSINEEVERLRHSATNSLLTRRDVVVVASVSCIYGLGTPQEYVDRMVRLHVGQEMDREE
LLRKFVTMQYTRNDMAFQRGTFRVRGDTVEIIPMYEELAVRIEFFGDEIEAVATLNPLTG
EVVRDEQEMYIFPATHYVAGPERMEKAISRIETELEQQLERFEQQGKLLEAQRLRMRTTY
DVEMMREMGSCNGIENYSLHIDGREPGSAPNCLLDYFPEDFLLVLDESHVTVPQIGAMFE
GDMSRKRTLVDHGFRLPSAMDNRPLKWEEFLERIGQTVYLSATPGDYELAKSDGYVEQII
RPTGLVDPEIVVKPTQGQIDDLLAEIRERAERNERVLVTTLTKKMAEDLTDYLLERQVRV
RYLHSEVDTLRRIELLKELRLGEYDVLVGINLLREGLDLPEVSLVSILDADKQGFLRSNR
SLIQTIGRAARNVSGQVHMYADKVTESMQYAIDETNRRRAVQIAHNTEHGIDPTPLRKKI
GDITEMLVEMQGLAGTWEGAEDPGRPTGRRGRAEAQDADVAADLAVATGDRPTDMPRAEL
AQLIQQLSDQMHTAASQLQFELAGRLRDEIADLRKELRQMERAGG
NT seq 2118 nt NT seq  +upstreamnt  +downstreamnt
atgcgccccgtcaccgacctccaacgcagcgtcgctcccttcgaggtggtctccgagtac
gaccccgccggggaccagccgaccgcgatcgccgagctgacccgccgcatcgaggcgggg
gagcaggacgtcgtcctgctgggcgcgaccggtaccggcaagtcggcgaccacggcatgg
atgatcgagaagctgcagcggcccaccctcgtgatggcccccaacaagacgttggccgcc
cagctggccaacgagttccgcgagctgctgccgaacaacgcggtcgagtacttcgtttcg
tactacgactactaccaacccgaggcgtacgtcccccagtcggacacctacatcgagaag
gactcctccatcaacgaggaggtcgagcggctgcggcacagtgccacgaactcgctgctc
acccgacgggacgtggtcgtggtggcgtcggtgtcctgcatctacggcctgggcaccccg
caggagtacgtcgaccgcatggtgcgcctgcacgtggggcaggagatggaccgcgaggag
ctcctgcgcaagttcgtcacgatgcagtacacccgcaacgacatggccttccagcggggc
accttcagagtccggggcgacacggtcgagatcatcccgatgtacgaggagctcgcggtg
cgcatcgagttcttcggcgacgagatcgaggcggtcgccaccctgaacccgctcaccggg
gaggtcgtgcgcgacgagcaggagatgtacatcttcccggccacccactacgtcgccggg
ccggagcgcatggagaaggcgatctcccgcatcgagaccgagctcgagcagcagctcgag
cgcttcgagcagcagggcaagctgctggaggcccagcggctgcgcatgcgcaccacctac
gacgtcgagatgatgcgggagatgggctcgtgcaacggcatcgagaactactcgctgcac
atcgacggacgcgagcccggctcggcgcccaactgcctgctcgactacttccccgaggac
ttcctgctggtgctcgacgagtcccacgtgacggtcccgcagatcggcgccatgttcgag
ggcgacatgtcacgcaagcggaccctggtggaccacggcttccgcctgcccagcgccatg
gacaaccggccgttgaagtgggaggagttcctcgagcgcatcggccagaccgtgtacctg
tcggccacgccgggggactacgagctggcgaagtcggacggctacgtggagcagatcatc
cggcccaccggcctggtggacccggagatcgtcgtcaagcccacgcagggccagatcgac
gacctgctggccgagatccgcgagcgggccgagcgcaacgagcgggtcctggtcaccacg
ctcaccaagaagatggccgaggacctcaccgactacctgctggagcggcaggtgcgcgtg
cgctacctgcacagcgaggtcgacaccctgcgccgcatcgagctgctcaaggagctgcgg
ctgggggaatacgacgttctggtgggcatcaacctgctgcgcgagggcctggacctgccc
gaggtgtcgctcgtgagcatcttggacgcggacaagcagggcttcctgcgttccaaccgg
tccctcatccagaccatcggccgcgcggcccgcaacgtctccggccaggtgcacatgtac
gcggacaaggtcaccgagtccatgcagtacgccatcgacgagaccaaccgccggcgggcg
gttcagatcgcgcacaacaccgagcacggcatcgacccgaccccgctgcgcaagaagatc
ggcgacatcaccgagatgctcgtggagatgcagggcctggccgggacctgggagggcgcc
gaggaccccggacgcccgacgggacgccgggggagggccgaggcccaggacgccgacgtc
gccgccgacctggcggtggccacgggcgaccgcccgaccgacatgcccagggcggagctc
gcccagctcatccagcagctctcggaccagatgcacacggcggccagccagctgcagttc
gagctcgccgggcgcctgcgggacgagatcgccgacctgcgcaaggaactgcggcagatg
gagcgcgccggagggtga

DBGET integrated database retrieval system