KEGG   Kytococcus sedentarius: Ksed_13130Help
Entry
Ksed_13130        CDS       T00974                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
kse  Kytococcus sedentarius
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:kse01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:kse01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:kse00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:kse00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:kse00562]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1363335..1364126
Genome map
AA seq 263 aa AA seqDB search
MTERLPLIAGNWKMNLDHLQATHLVQKLDWVLRDASHSFDAVEVAVFPPFTHLRSVETLI
MADKLDIKLGAQDLSEHASGAHTGDISGGMLAKLGCEFVIVGHSERREHHAETDAVVHLK
VKAALAAGLAPIVCVGESSETRAAGEHLAFVTRQVAAALEGLSAEELAHAVIAYEPVWAI
GTGEVASSADAQEVCAAIREQVAHTHGAELAAGMRVLYGGSVKPTNIAEIMDEADVDGAL
VGGASLTAEEFASIVRFRSHHGR
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagcgcctcccgctgatcgcgggcaactggaagatgaacctcgaccacctgcaa
gccacccacctggtgcagaagctcgactgggtgctgcgggacgcctcgcacagcttcgat
gcggtggaggtggcagtcttcccgccgttcacgcacctgcgcagcgtcgagacgctgatc
atggccgacaagctcgacatcaagctcggggcccaggacctctcggagcacgcctccggc
gcgcacaccggagacatctccggcggcatgctggccaagctcggctgcgagttcgtcatc
gtgggccactccgagcgccgcgagcaccacgcggagaccgatgcggtggtgcacctgaag
gtcaaggccgccctggcggccgggctggcccccatcgtctgcgtgggggagtcctccgag
acgcgtgcggccggcgagcacctggccttcgtcacccggcaggtcgccgcggccctggag
ggcctgtccgccgaggagctcgcccacgccgtcatcgcctacgagcccgtctgggcgatc
ggcaccggcgaggtggcctccagcgccgacgcgcaggaggtctgtgcagcgatccgcgag
caggtcgcgcacacccacggggcggagctggccgcggggatgcgcgtgctctacggcggg
tcggtcaagccgacgaacatcgccgagatcatggacgaggccgacgtggacggcgccctg
gtcggcggcgcctcgctcaccgccgaggagttcgcctcgatcgtccgcttccggtcccac
cacggccgctga

DBGET integrated database retrieval system