KEGG   Kytococcus sedentarius: Ksed_13130Help
Entry
Ksed_13130        CDS       T00974                                 

Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
kse  Kytococcus sedentarius
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:kse00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ksed_13130
   01230 Biosynthesis of amino acids
    Ksed_13130
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ksed_13130
   00051 Fructose and mannose metabolism
    Ksed_13130
   00562 Inositol phosphate metabolism
    Ksed_13130
Enzymes [BR:kse01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Ksed_13130
Exosome [BR:kse04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Ksed_13130
  Exosomal proteins of bladder cancer cells
   Ksed_13130
  Exosomal proteins of melanoma cells
   Ksed_13130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1363335..1364126
Genome map
AA seq 263 aa AA seqDB search
MTERLPLIAGNWKMNLDHLQATHLVQKLDWVLRDASHSFDAVEVAVFPPFTHLRSVETLI
MADKLDIKLGAQDLSEHASGAHTGDISGGMLAKLGCEFVIVGHSERREHHAETDAVVHLK
VKAALAAGLAPIVCVGESSETRAAGEHLAFVTRQVAAALEGLSAEELAHAVIAYEPVWAI
GTGEVASSADAQEVCAAIREQVAHTHGAELAAGMRVLYGGSVKPTNIAEIMDEADVDGAL
VGGASLTAEEFASIVRFRSHHGR
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagcgcctcccgctgatcgcgggcaactggaagatgaacctcgaccacctgcaa
gccacccacctggtgcagaagctcgactgggtgctgcgggacgcctcgcacagcttcgat
gcggtggaggtggcagtcttcccgccgttcacgcacctgcgcagcgtcgagacgctgatc
atggccgacaagctcgacatcaagctcggggcccaggacctctcggagcacgcctccggc
gcgcacaccggagacatctccggcggcatgctggccaagctcggctgcgagttcgtcatc
gtgggccactccgagcgccgcgagcaccacgcggagaccgatgcggtggtgcacctgaag
gtcaaggccgccctggcggccgggctggcccccatcgtctgcgtgggggagtcctccgag
acgcgtgcggccggcgagcacctggccttcgtcacccggcaggtcgccgcggccctggag
ggcctgtccgccgaggagctcgcccacgccgtcatcgcctacgagcccgtctgggcgatc
ggcaccggcgaggtggcctccagcgccgacgcgcaggaggtctgtgcagcgatccgcgag
caggtcgcgcacacccacggggcggagctggccgcggggatgcgcgtgctctacggcggg
tcggtcaagccgacgaacatcgccgagatcatggacgaggccgacgtggacggcgccctg
gtcggcggcgcctcgctcaccgccgaggagttcgcctcgatcgtccgcttccggtcccac
cacggccgctga

DBGET integrated database retrieval system