KEGG   Kytococcus sedentarius: Ksed_14820Help
Entry
Ksed_14820        CDS       T00974                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
kse  Kytococcus sedentarius
Pathway
kse00260  Glycine, serine and threonine metabolism
kse00750  Vitamin B6 metabolism
kse01100  Metabolic pathways
kse01110  Biosynthesis of secondary metabolites
kse01120  Microbial metabolism in diverse environments
kse01230  Biosynthesis of amino acids
Module
kse_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:kse00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ksed_14820
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Ksed_14820
Enzymes [BR:kse01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Ksed_14820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N Plant_vir_prot
Motif
Other DBs
NCBI-ProteinID: ACV06507
UniProt: C7NI00
Position
1522845..1524359
Genome map
AA seq 504 aa AA seqDB search
MRFTSTRGGVDPQGAARAILTGLAPDGGLFVPERIAPLEVEDLLDAGWVDVATAVMEPYL
TGDGGLGEGDLRQAVTTAAARFETDEVVPVDLLGEGASSIGLLALFGGPTHAFKDVALTL
LPHLVTLARRAEGEAGTTLVLTATSGDTGKAALEGFKDVPETEVVVLYPTEGVSFMQKQQ
MRTQAGDNVHVLGIHGDFDDAQRAVKALFADAGARERLDARGYSISSANSINLGRLLPQM
VYYVTGYAALRSAGVVAAGEPVDVVVPTGNFGNLLAATWARAAGVPLGALVCATNENRVL
ADFFATGTYDARRRLVRTDSPSMDILVSSNLERYLYEASGGDTDRVRTALETLARHRRFD
WGELPGAGANPVLAGTATRKEAADALRRVHAEHGTLVDPHTAVALHVLEQYRAGQLTDGT
VPPARPALVAATASPYKFAPAVLGALGGEADPDEFETLLRLATHAADERGAPAGLAGLRE
AEVLHDRVVEVDEVPATIEEVLHR
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgaggttcaccagcacccgcggcggggtggacccgcaaggtgccgcccgtgccatcctc
accggcctggccccggacggcggcctgttcgtgcccgagcggatcgcccctctcgaggtc
gaggacctgctcgacgcaggctgggtggacgtggccacggcggtgatggagccctacctg
accggcgacggggggctcggtgagggtgacctgcggcaggcggtcaccaccgcggccgcc
cgcttcgagaccgacgaggtggtcccggtggacctgctcggcgagggtgcctccagcatc
ggcctgctcgcgctgttcggcggtcccacccacgcgttcaaggacgtggccctgaccctg
ctgccccacctggtgacgctcgcgcgccgggccgagggcgaggccggcaccacgctggtg
ctcaccgccaccagcggcgacacgggcaaggcggccctggagggtttcaaggacgtgccc
gagaccgaggtggtggtgctctaccccaccgagggcgtgagcttcatgcagaagcagcag
atgcgcacccaggccggggacaacgtgcacgtgctgggcatccacggggacttcgacgac
gcccagcgcgccgtcaaggccctcttcgccgatgcgggggcgcgggagcgcctggacgcg
cgcggctactcgatcagctcggccaactcgatcaacctcggccgcctgctgccgcagatg
gtctactacgtcaccggctacgcggcgctgcgcagcgcgggcgtggtggccgctggtgag
ccggtggacgtcgtggtgcccaccggcaacttcgggaacctgctcgcggccacctgggcc
cgcgccgccggggtgcccctgggagcgctggtctgcgcgaccaacgagaaccgggtgctg
gccgacttcttcgccaccggcacctacgacgcgcgccgccgcctggtgcgcaccgactcc
ccgtccatggacatcctcgtctcgagcaacctggagcggtacctgtacgaggccagtggc
ggcgacaccgaccgggtgcgcacggcgctggagaccctcgcccgtcaccgccgcttcgac
tggggggagctcccgggcgccggggcgaacccggtactggccggcaccgcgacccgcaag
gaggccgccgacgccctgcggcgcgtgcacgccgagcacggcaccctggtggacccgcac
accgccgtggccctgcacgtgctggagcagtaccgcgccggtcagctcaccgacggcacg
gtgccgccggcccgcccggccctggtggccgcgacggccagcccctacaagttcgccccc
gcagtgttgggcgcgctggggggcgaggcagacccggacgagttcgagacgctgctgcgc
ctggccacccacgcggccgacgagcggggtgcccccgccgggctcgccggcctgcgggag
gccgaggtgctccacgaccgggtggtcgaggtcgacgaggtgcccgccaccatcgaggag
gtcctgcaccgatga

DBGET integrated database retrieval system