KEGG   Kytococcus sedentarius: Ksed_15700Help
Entry
Ksed_15700        CDS       T00974                                 

Definition
(GenBank) UDP-N-acetylglucosamine 1-carboxyvinyltransferase
  KO
K00790  UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
kse  Kytococcus sedentarius
Pathway
kse00520  Amino sugar and nucleotide sugar metabolism
kse00550  Peptidoglycan biosynthesis
kse01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kse00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Ksed_15700
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Ksed_15700
Enzymes [BR:kse01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     Ksed_15700
Peptidoglycan biosynthesis and degradation proteins [BR:kse01011]
 Precursor biosynthesis
  Transferase/Dehydrogenase
   Ksed_15700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EPSP_synthase HTH_3 HTH_31 HTH_37 HTH_19 HTH_26 HTH_25 YdaS_antitoxin Sigma70_r4 HTH_23 HTH_38 Pou BetR
Motif
Other DBs
NCBI-ProteinID: ACV06585
UniProt: C7NI78
Position
1608737..1610260
Genome map
AA seq 507 aa AA seqDB search
MTDEYLARIGNLIRDARLHRGMTQTQVADILNTSQSAVARMEQGKQNLSLETVAKVSEAL
DHDIVIPASMPQHLRIEGGRKLSGSIDVRTSKNAAVALLCASLLNRGTTTLRNLARIEEV
NRILEVLNSIGIETKWLGDSNDLRITPPETLRLEDIDEAAARRTRSIIMFLGPLLHRYPE
FQLPYAGGCDLGTRTVGPHLNSLKPFGLEVLATDGQYNATVNKKAPGRPIVLTERGDTVT
ENAIMAAAMEPTTTVIRNASSNYMVQDLCFFLEELGVKIDGIGTTTLTITGVEDINADVE
YSPSEDPIEAMSLLAAAIVTQSEITINRAPIEFLEIELATLEHMGMKYELSEEYTSKNGR
TRLADLTYKPGPLAAPQDKVHSMPYPGLNIDNLPFFVIIGAMAEGKTLVHDWVYENRAIH
LTELSTLGARVQLLDPHRIQVEGPTRWRAAEIMCPPALRPGVVILLGMLAAPGTSVLRNV
YVINRGYEALADRLNELGASITVFRDI
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgactgatgagtacttggcacggatcgggaacctcatccgcgacgcgcgactgcaccga
ggcatgacgcagacgcaggtggcggacatcctgaacaccagccagagcgccgtggcgcgg
atggagcagggcaagcagaacctctccctggagacggtggcgaaggtcagcgaggcgctg
gaccacgacatcgtgatccccgcctccatgccccagcacctgcgcatcgagggcggacgc
aagctgtccggatcgatcgacgtgcgcacctccaagaacgccgccgtggccctgctgtgc
gcctcgctgctcaaccgcggcaccaccaccctgcgcaacctggcccgcatcgaagaggtc
aaccgcatcctcgaggtgctgaactccatcggcatcgagaccaagtggctgggcgacagc
aacgacctgcgcatcacgccgccggagaccctccgtctggaggacatcgacgaggccgcg
gcccgccgcacccgctcgatcatcatgttcctcggcccgctgctgcaccgctaccccgag
ttccagctcccctacgccgggggctgcgacctgggcacccgcaccgtcggcccgcacctg
aactccctcaagcccttcggcctggaggtgctggccaccgacggccagtacaacgcgacg
gtcaacaagaaggccccgggccgccccatcgtgctcaccgagcggggcgacaccgtcacc
gagaacgcgatcatggccgccgcgatggaaccgaccaccacggtgatccgcaacgcctcc
agcaactacatggtccaggacctgtgcttcttcctggaggagctgggggtgaagatcgac
ggcatcggcaccacgaccctcaccatcaccggtgtggaggacatcaacgccgacgtggag
tactcccccagcgaggacccgatcgaggccatgagcctgctggccgccgcgatcgtgacc
cagtcggagatcaccatcaaccgagcccccatcgagttcctcgagatcgagctggcgacg
ctcgagcacatgggcatgaagtacgagctatccgaggagtacacctccaagaacggccgt
acccggctggcggacctgacctacaagcccggccccctggccgcgccgcaggacaaggtc
cactcgatgccgtacccgggcctgaacatcgacaacctgcccttcttcgtcatcatcggc
gcgatggccgagggcaagaccctggtgcacgactgggtgtacgagaaccgcgcgatccac
ctcaccgagctctccacgctgggtgcgcgggtgcagctgctggacccgcaccgcatccag
gtggagggccccacccgctggcgcgccgcggagatcatgtgcccgccggcactgcgcccc
ggcgtcgtgatcctgctgggcatgctcgctgcccccggcacctcggtgctgcgcaacgtc
tacgtgatcaaccgcgggtacgaggcgctggccgaccggctcaacgagctcggcgccagc
atcacggtgttccgcgacatctga

DBGET integrated database retrieval system