KEGG   Kytococcus sedentarius: Ksed_15890Help
Entry
Ksed_15890        CDS       T00974                                 

Definition
acyl-CoA synthetase/AMP-acid ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
kse  Kytococcus sedentarius
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:kse00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ksed_15890
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ksed_15890
   00620 Pyruvate metabolism
    Ksed_15890
   00640 Propanoate metabolism
    Ksed_15890
  Energy metabolism
   00680 Methane metabolism
    Ksed_15890
Enzymes [BR:kse01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Ksed_15890
Lipid biosynthesis proteins [BR:kse01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Ksed_15890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1632286..1634049
Genome map
AA seq 587 aa AA seqDB search
MSTPTAEFHAARDAVLALHDADDAAVDAFVMPRPTEFNWGLHHIDAVAAGPRADTPALRI
VDIVKDGTRTHQLTWAEVSATSSQMANHLRDNGVARGDRVLVMLGNQTELWQVMVGCIKL
GAEVIPATTLLTPEDLTDRVARGKVKHVITNAYEARTFAKVDGEFQRFAVCGDDETPEGW
LRLEDFASAPTEFTPEAPTRADDTMLLYFTSGTTSAPKLVEHTHTSYTYGALSTMFWVGL
RPGDVHVNISSPGWAKHAWSSLFTPWTAEATILVINQPRFDAATLLQVLADEGATTFCAP
PTVYRMLIQQDLAAWRERLAIREMVGAGEPLNPEVIRAVEKGLGVTIRDGFGQTETTAQI
GNPPGRPLKPGSMGRPLPGYDVVLLDAATGTEVTEPGEEGELCLRLEGAGGRPIGLMVGY
HGDADRTAASMRDGAYHTGDVAMRDADGYITYVGRADDVFKASDYRISPFEVESVLIEHE
LVAEAAVIPSPDPTRLAVPKAYVVLVEGTEPSREIAESILSYCRANLAPYKRVRRLEFGE
LPKTVSGKIRRVELKARENEFHPVGDDPTERASEWEFWESDFPDLKG
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atgagcacacccaccgctgagttccacgccgcccgtgacgccgtcctggcgctgcacgac
gccgacgacgcagcagtcgacgccttcgtgatgccccgcccgacggagttcaactggggc
ctgcaccacatcgatgccgtggccgccggcccgcgcgcggacacccccgcgctgcggatc
gtcgacatcgtgaaggacggcacccgcacccaccagctgacctgggccgaggtttccgcc
acctcctcccagatggccaaccacctgcgggacaacggggtcgcgcgcggggaccgcgtg
ctggtgatgctcggcaaccagaccgagctgtggcaggtgatggtcggctgcatcaagctc
ggcgcagaggtcatcccggccaccaccctgctcaccccggaggacctcaccgaccgggtc
gcccgcgggaaggtgaagcacgtcatcaccaacgcgtacgaggccaggaccttcgccaag
gtggacggtgagttccagcgcttcgccgtctgcggggacgacgagacacccgagggctgg
ctgcgcctggaggacttcgcctctgcccccaccgagttcacccccgaggccccgacccgg
gccgacgacacgatgctgctctacttcacctccggcaccacctcggcgcccaagctggtg
gagcacacgcacaccagctacacctacggggccctgtccaccatgttctgggtgggcctg
cgccccggggacgtgcacgtgaacatctcctcccccggctgggccaagcacgcgtggagc
tcgttgttcacgccatggacggccgaggccaccatcctggtcatcaaccagccgcgcttc
gacgccgccacgctgctgcaggtgctggccgacgagggcgccaccaccttctgcgcgccg
ccgacggtctaccgcatgctcatccagcaggacctggccgcctggcgcgagcgcctggcc
atccgcgagatggtcggggccggcgagccgctgaaccccgaggtgatccgcgcggtcgag
aagggcctgggcgtgaccatccgcgacggcttcggccagaccgagaccaccgcccagatc
ggcaacccgcccggccgaccgctcaagcccggctcgatggggcgtccgctgcccgggtac
gacgtggtgctgctcgatgcggccaccggcaccgaggtgaccgaacccggcgaggagggc
gagctgtgcctccgcctcgagggggcgggagggcgccccatcggcctgatggtgggctac
cacggtgatgccgaccgcaccgcggcgtcgatgcgggacggggcgtaccacaccggtgac
gtggccatgcgtgacgccgacggctacatcacctacgtggggcgcgccgacgacgtgttc
aaggccagcgactaccgcatcagcccgttcgaggtggagtcggtcctcatcgagcacgag
ctcgtggccgaggccgccgtgatcccctcccccgacccgacgcgcctggcggtgccgaag
gcctacgtcgtgctcgtggagggcaccgagcccagccgggagatcgccgagtcgatcctg
tcctactgccgcgcgaacctggccccctacaagcgggtgcgccggctggagttcggcgag
ctgcccaagacggtctcgggcaagatccggcgcgtggagctcaaggcgcgcgagaacgag
ttccacccggtcggcgacgaccccaccgagcgggcgagcgagtgggagttctgggagagc
gacttccccgacctgaagggctga

DBGET integrated database retrieval system