KEGG   Kytococcus sedentarius: Ksed_16110Help
Entry
Ksed_16110        CDS       T00974                                 

Definition
esterase/lipase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
kse  Kytococcus sedentarius
Brite
Enzymes [BR:kse01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     Ksed_16110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1658025..1658816
Genome map
AA seq 263 aa AA seqDB search
MAPPTPVIEPVTPPLPGGEGRYLPGPQGSAQVVLCHGFTGTAQSLGRWPEALQQAGFSVD
VPRLPGHGRTWQAANRTGWEDWYRIAERSLLRASELRPAVVGGLSMGGALALALAVAHPG
RVAGVILVNPAVAAVNPFVPLTPLVRHVRPSMPGIAGDVADPDSPGELAYDRVPMHALNS
QRALWRGVRRRAREVTCPVLLMRSAVDHVVPARSSASILRRISSTDVREVVLENSFHVVP
LDHDAPRVHEESVAFARRVTGDQ
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atggcgccccccacccccgtcatcgaaccggtcacccctcccctgcccggcggagagggc
cgatacctgccggggccgcagggctcggcccaggtggtcttgtgccacggcttcaccggg
acggcgcaatcgctggggcgttggcccgaggcgctccagcaggccgggttctccgtggac
gttccgcggcttcccgggcacggacgcacctggcaggcggcgaaccggaccggctgggag
gactggtaccgcatcgccgaacggtccctcctgcgcgccagcgagctccgtcccgccgtg
gtcggcggcctgtcgatggggggcgcgctcgccctggcgctcgccgtcgcccaccccggc
cgggtggccggtgtgatcttggtcaacccggccgtcgcggcggtcaaccccttcgtgccc
ctcacccccctggtgcgccacgtccggccgtcgatgcccggcatcgccggcgacgtcgcc
gatcccgacagtcccggtgagctggcctatgaccgggtgcccatgcacgcgttgaactcc
cagcgggccctgtggcggggagtgcggcggcgggcgcgcgaggtcacctgcccggtcctg
ctgatgcgttcggccgtggaccacgtagtgccggcccgcagcagtgccagcatcctgcgg
cggatctcctcgacggacgtccgcgaggtcgtgctcgagaacagcttccacgtggtcccg
ctcgaccacgacgccccccgcgtccacgaggagtccgtggccttcgcccgccgggtgacc
ggcgaccagtga

DBGET integrated database retrieval system