KEGG   Kytococcus sedentarius: Ksed_16120Help
Entry
Ksed_16120        CDS       T00974                                 

Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
kse  Kytococcus sedentarius
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:kse00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ksed_16120
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ksed_16120
   00052 Galactose metabolism
    Ksed_16120
   00500 Starch and sucrose metabolism
    Ksed_16120
   00520 Amino sugar and nucleotide sugar metabolism
    Ksed_16120
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Ksed_16120
   00524 Butirosin and neomycin biosynthesis
    Ksed_16120
Enzymes [BR:kse01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Ksed_16120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1658821..1659783)
Genome map
AA seq 320 aa AA seqDB search
MSLAIGVDIGGTKIAGALVRDGEILQRARVETPAEDVGAIVEAVTTVIQDLQGKAGGEDV
VGAGIACAGLVDAAGETILFAPNLAWRDEPLKAKVAAQVDLPIRLENDANAAAWGEFRHG
AARDHDDMTLITVGTGIGGGIVNDGTLLRGAAGVGAEIGHMRVVRDGLRCGCGNRGCWEQ
YGSGSALVREARDLIRSGTPHAARLSGACGGDPDALEGADVTKVAEEGDPAAAELIHELG
VWIGEGAASLAAILDPAAIVIGGGVSAAGDLLLEPARRAFHRNLTGRGYRPWPEMVMASL
GNDAGVIGAASIMLDERPTS
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgtccctcgccatcggtgtcgacatcggaggcaccaagatcgctggggccctggtccgg
gacggcgagatcctccagcgggcgcgggtcgagacccccgccgaggacgtcggagccatc
gtcgaggccgtgaccacggtcatccaggacctccagggcaaggcggggggcgaggacgtc
gtgggtgccggcatcgcgtgtgcaggcctggtggacgccgcgggcgagaccatcctgttc
gccccgaacctggcgtggcgggacgagcccctcaaggcgaaggtggccgcccaggtcgac
ctgccgatccggctggagaacgacgccaacgcggcagcctggggggagttccgccacgga
gctgcccgggaccacgacgacatgaccctcatcaccgtcgggaccggcatcggcggcggc
atcgtcaacgatggcaccctcctgcgaggcgctgccggagtgggcgccgagatcggccac
atgcgcgtggtgcgcgacggcctgcgctgcgggtgcggcaaccgcggctgctgggagcag
tacggctcgggcagcgccctggtccgcgaggcccgcgacctcatccggtccggtaccccc
cacgcagctcgcctcagcggcgcctgcgggggcgatcccgacgcgctcgagggggccgac
gtcacgaaggtggccgaggagggcgaccccgcggcggcggagctcatccacgagctgggg
gtctggatcggcgagggcgcagccagcctcgcggcgatcctcgacccggcggcgatcgtc
atcggcggcggggtgagtgctgccggcgacctgctgctcgagcccgctcgccgggccttc
caccgcaatctcaccggtcgcggttaccgcccgtggccggagatggtgatggcgagcctg
ggcaacgacgcgggcgtcatcggcgcggcctcgatcatgctcgacgagcggcccacgagc
tga

DBGET integrated database retrieval system