KEGG   Kytococcus sedentarius: Ksed_16350Help
Entry
Ksed_16350        CDS       T00974                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase E2 component
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
kse  Kytococcus sedentarius
Pathway
kse00020  Citrate cycle (TCA cycle)
kse00310  Lysine degradation
kse01100  Metabolic pathways
kse01110  Biosynthesis of secondary metabolites
kse01120  Microbial metabolism in diverse environments
kse01130  Biosynthesis of antibiotics
kse01200  Carbon metabolism
Module
kse_M00009  Citrate cycle (TCA cycle, Krebs cycle)
kse_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:kse00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Ksed_16350
  Amino acid metabolism
   00310 Lysine degradation
    Ksed_16350
Enzymes [BR:kse01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Ksed_16350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H
Motif
Other DBs
NCBI-ProteinID: ACV06650
UniProt: C7NIL2
Position
1682047..1683948
Genome map
AA seq 633 aa AA seqDB search
MSEKVTMPELGESVTEGTVTRWLKGVGDEVAVDEPLLEVSTDKVDTEIPSPVAGVLQEIL
AEEDDTVEVGGDLAVIGDDEGGSSDDSGDSEEDSEPAEDEKAEEEPAQDEESEEPAQDEE
AQDDSADEKPKKSSGGGGGEGQTVTMPELGESVTEGTVTRWLKEEGDEVEVDEPLLEVST
DKVDTEIPSPYAGVLSKIIAGEDETIEVGGELGVIGGEAGGDDAGDSEDEKPKEEEKAEE
KAADSSEDDSMEAGTAEEVAAGADQGGDADAKGEQEKSEKPAKEEPKKEEKPAKDQKSED
KDSSGSDTYVTPLVRKLAKQHGVDLSSLEGSGVGGRIRKQDVLAAAEGKDSAKAEEPAAE
EKPAAEKASAEGKDSAKSGSKDSGAPAKSSGGALEGLQAKRGTTEKMSRLRKVIAQRMME
SLQVSAQLTTVVEVDVTKIARLRDRTKKDFQAREGVKLSFLPFFAQAAIEALKEHPTVNA
SLEGDEIIYHAQENLGMAVDTEKGLLVPVIKDAGSLNIAGIARKIDDLATRTRDNKVGPD
ELSGATFTLTNTGSRGALFDTPIINQPNVAILGTGAVVKRPVVVSDEDGLETIAIRSMVY
LALSYDHRIVDGADAARFLGTMKERLESGQFDV
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaaaggtgacgatgccggagctcggcgagtccgtgaccgagggcacggtgacc
cgctggctgaagggcgttggtgacgaggttgcggtcgacgagccgctgctcgaggtctcc
accgacaaggtggacaccgagatcccctccccggtggcgggagtgctgcaggagatcctc
gccgaggaggacgacacggtcgaggtcggtggcgacctggccgtcatcggcgacgacgag
ggtggctcgtccgacgactcgggtgactccgaggaggacagcgagcccgccgaggacgag
aaggccgaggaggagcccgcgcaggacgaggagtccgaggagccggcgcaggacgaggag
gcccaggacgactccgcggacgagaagccgaagaagtcctccggtggtggcggcggcgag
ggccagaccgtcacgatgccggagctcggcgagtccgtgaccgagggcaccgtcacccgc
tggctgaaggaggagggcgacgaggtcgaggtcgacgagcccctgctcgaggtctccacc
gacaaggtcgacaccgagatcccctccccctacgcgggtgtgctgtccaagatcatcgcc
ggcgaggacgagaccatcgaggtcggcggcgagctcggtgtgatcggtggcgaggccggc
ggtgacgacgcgggcgactccgaggacgagaagccgaaggaggaggagaaggccgaggag
aaggccgccgactcctccgaggacgactcgatggaggccgggaccgccgaggaggtggcc
gccggcgccgaccagggtggcgacgccgacgcgaagggcgagcaggagaagtccgagaag
cccgccaaggaagagccgaagaaggaggagaagcccgccaaggaccagaagtccgaggac
aaggactcctccggttccgacacctacgtgacccccttggtgcgcaagctggccaagcag
cacggcgtggacctctccagcctggagggttccggcgtgggtggccgcatccgcaagcag
gacgtgctggccgctgccgagggcaaggactccgcaaaggccgaggagcccgccgccgag
gagaagcccgctgcggagaaggcgtccgccgagggcaaggactccgcgaagtccgggtcc
aaggactccggcgctccggcgaagtcctccggtggggccctggagggcctgcaggccaag
cgcggcaccaccgagaagatgagccggctgcgcaaggtcatcgcccagcgcatgatggag
tcgctgcaggtctcggcgcagctcaccaccgtggtcgaggtggacgtcaccaagatcgcc
cgactgcgtgaccgcacgaagaaggacttccaggcgcgcgagggcgtgaagctctctttc
ctgcccttcttcgcgcaggccgccatcgaggcgctcaaggagcacccgacggtgaacgcc
agcctggagggcgacgagatcatctaccacgcccaggagaacctgggtatggccgtcgac
accgagaagggcctgctggtcccggtcatcaaggacgccggttcgctgaacatcgccggc
atcgcccgcaagatcgacgacctggccacccgcacccgcgacaacaaggtgggcccggac
gagctgagcggcgcgaccttcacgctgaccaacaccggttcgcgcggggcgctgttcgac
acgccgatcatcaaccaaccgaacgtggcgatcctcggcaccggtgccgtggtgaagcgt
ccggtcgtggtgagcgacgaggacggcctggagaccatcgccattcgctcgatggtgtac
ctggccctgtcctacgaccaccgcatcgtggacggcgccgacgccgcgcgcttcctgggc
accatgaaggagcgtctggagagcggtcagttcgacgtctga

DBGET integrated database retrieval system