KEGG   Kytococcus sedentarius: Ksed_16350Help
Entry
Ksed_16350        CDS       T00974                                 

Definition
2-oxoglutarate dehydrogenase E2 component
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
kse  Kytococcus sedentarius
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:kse00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ksed_16350
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Ksed_16350
  Amino acid metabolism
   00310 Lysine degradation
    Ksed_16350
Enzymes [BR:kse01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Ksed_16350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1682047..1683948
Genome map
AA seq 633 aa AA seqDB search
MSEKVTMPELGESVTEGTVTRWLKGVGDEVAVDEPLLEVSTDKVDTEIPSPVAGVLQEIL
AEEDDTVEVGGDLAVIGDDEGGSSDDSGDSEEDSEPAEDEKAEEEPAQDEESEEPAQDEE
AQDDSADEKPKKSSGGGGGEGQTVTMPELGESVTEGTVTRWLKEEGDEVEVDEPLLEVST
DKVDTEIPSPYAGVLSKIIAGEDETIEVGGELGVIGGEAGGDDAGDSEDEKPKEEEKAEE
KAADSSEDDSMEAGTAEEVAAGADQGGDADAKGEQEKSEKPAKEEPKKEEKPAKDQKSED
KDSSGSDTYVTPLVRKLAKQHGVDLSSLEGSGVGGRIRKQDVLAAAEGKDSAKAEEPAAE
EKPAAEKASAEGKDSAKSGSKDSGAPAKSSGGALEGLQAKRGTTEKMSRLRKVIAQRMME
SLQVSAQLTTVVEVDVTKIARLRDRTKKDFQAREGVKLSFLPFFAQAAIEALKEHPTVNA
SLEGDEIIYHAQENLGMAVDTEKGLLVPVIKDAGSLNIAGIARKIDDLATRTRDNKVGPD
ELSGATFTLTNTGSRGALFDTPIINQPNVAILGTGAVVKRPVVVSDEDGLETIAIRSMVY
LALSYDHRIVDGADAARFLGTMKERLESGQFDV
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaaaggtgacgatgccggagctcggcgagtccgtgaccgagggcacggtgacc
cgctggctgaagggcgttggtgacgaggttgcggtcgacgagccgctgctcgaggtctcc
accgacaaggtggacaccgagatcccctccccggtggcgggagtgctgcaggagatcctc
gccgaggaggacgacacggtcgaggtcggtggcgacctggccgtcatcggcgacgacgag
ggtggctcgtccgacgactcgggtgactccgaggaggacagcgagcccgccgaggacgag
aaggccgaggaggagcccgcgcaggacgaggagtccgaggagccggcgcaggacgaggag
gcccaggacgactccgcggacgagaagccgaagaagtcctccggtggtggcggcggcgag
ggccagaccgtcacgatgccggagctcggcgagtccgtgaccgagggcaccgtcacccgc
tggctgaaggaggagggcgacgaggtcgaggtcgacgagcccctgctcgaggtctccacc
gacaaggtcgacaccgagatcccctccccctacgcgggtgtgctgtccaagatcatcgcc
ggcgaggacgagaccatcgaggtcggcggcgagctcggtgtgatcggtggcgaggccggc
ggtgacgacgcgggcgactccgaggacgagaagccgaaggaggaggagaaggccgaggag
aaggccgccgactcctccgaggacgactcgatggaggccgggaccgccgaggaggtggcc
gccggcgccgaccagggtggcgacgccgacgcgaagggcgagcaggagaagtccgagaag
cccgccaaggaagagccgaagaaggaggagaagcccgccaaggaccagaagtccgaggac
aaggactcctccggttccgacacctacgtgacccccttggtgcgcaagctggccaagcag
cacggcgtggacctctccagcctggagggttccggcgtgggtggccgcatccgcaagcag
gacgtgctggccgctgccgagggcaaggactccgcaaaggccgaggagcccgccgccgag
gagaagcccgctgcggagaaggcgtccgccgagggcaaggactccgcgaagtccgggtcc
aaggactccggcgctccggcgaagtcctccggtggggccctggagggcctgcaggccaag
cgcggcaccaccgagaagatgagccggctgcgcaaggtcatcgcccagcgcatgatggag
tcgctgcaggtctcggcgcagctcaccaccgtggtcgaggtggacgtcaccaagatcgcc
cgactgcgtgaccgcacgaagaaggacttccaggcgcgcgagggcgtgaagctctctttc
ctgcccttcttcgcgcaggccgccatcgaggcgctcaaggagcacccgacggtgaacgcc
agcctggagggcgacgagatcatctaccacgcccaggagaacctgggtatggccgtcgac
accgagaagggcctgctggtcccggtcatcaaggacgccggttcgctgaacatcgccggc
atcgcccgcaagatcgacgacctggccacccgcacccgcgacaacaaggtgggcccggac
gagctgagcggcgcgaccttcacgctgaccaacaccggttcgcgcggggcgctgttcgac
acgccgatcatcaaccaaccgaacgtggcgatcctcggcaccggtgccgtggtgaagcgt
ccggtcgtggtgagcgacgaggacggcctggagaccatcgccattcgctcgatggtgtac
ctggccctgtcctacgaccaccgcatcgtggacggcgccgacgccgcgcgcttcctgggc
accatgaaggagcgtctggagagcggtcagttcgacgtctga

DBGET integrated database retrieval system