KEGG   Kytococcus sedentarius: Ksed_22500Help
Entry
Ksed_22500        CDS       T00974                                 

Definition
Zn-dependent alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
kse  Kytococcus sedentarius
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:kse00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Ksed_22500
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ksed_22500
  Lipid metabolism
   00071 Fatty acid degradation
    Ksed_22500
  Amino acid metabolism
   00350 Tyrosine metabolism
    Ksed_22500
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Ksed_22500
   00626 Naphthalene degradation
    Ksed_22500
Enzymes [BR:kse01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Ksed_22500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2332019..2333071)
Genome map
AA seq 350 aa AA seqDB search
MRAVVIDEVGVLPTVREVPEPPCPPGGVVLDVAATGVCRSDWHAWMGHDEVALPHVPGHE
LAGTIRQVGEGVTRWRVGDRVTTPFVCGCGACPTCAAGDSQVCPQQTQPGFTGWGSWAEQ
VALHAADHNLVALPDSLGDVHAAALGCRFATSYRALVTHGGVGPGQWVAVHGAGGAGLSA
VLIARALRARVVAVDMAPAALERARALGAEDTLDARGLSPEQVGEAVHDLTDGGAHVSLD
AFGSPAAALASVLGLRRRGRHVQVGLLLGEAARTALPMDRVVAWELAIHGTHGLAARDYP
AMLELVTGSGGRPGIALEGLVGREVGLEDAPAALAELGAAPGGGITVIRP
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgccgtggtgatcgacgaggtcggggtcctgccaaccgtccgggaggtgcccgag
ccgccctgcccgcccggtggcgtcgtgctcgacgtcgcggccaccggcgtgtgccgctcc
gactggcacgcctggatgggccacgacgaggtcgccctgccgcacgtccccggccacgag
ctcgccggcaccatccgccaggtcggcgagggcgtgacccgctggcgcgtgggcgaccgc
gtgaccacccccttcgtgtgcggatgcggcgcctgccccacctgcgcggccggcgacagc
caggtctgcccgcagcagacgcagcccggcttcaccggctgggggtcctgggccgagcag
gtggccctccacgccgccgaccacaacctcgtcgccctgcccgactccctcggtgacgtg
cacgccgccgccctgggctgccgcttcgcgacctcctaccgggcgttggtgacccacggg
ggcgtcgggcccgggcagtgggtcgccgtgcacggggccggtggagcggggttgtcggcc
gtcctcatcgcccgtgcgctgagggcccgcgtggtggccgtcgacatggcgcccgcggcc
ctggagcgcgcccgtgccctgggcgccgaggacacgctggacgcccgcggcctgtcaccc
gagcaggtcggcgaggccgtgcacgacctgaccgatgggggagcgcacgtctcgctcgac
gccttcggttcgccggccgccgccctggcctcggtgctcggcctgcggcggcgcggacgc
cacgtgcaggtggggctgctgctcggcgaggccgcccggaccgcgctgccgatggaccgc
gtggtcgcttgggagctggccatccacggcacgcacggcctggcagcgcgcgactacccc
gcgatgctggagctcgtcactggctccggcgggcgtcccggcatcgcgctggaggggttg
gtcgggcgtgaggtgggcctcgaggacgccccggcggcgctcgcagagctgggggcggcg
ccgggtggtgggatcaccgtcatccgcccctga

DBGET integrated database retrieval system