KEGG   Kytococcus sedentarius: Ksed_23880Help
Entry
Ksed_23880        CDS       T00974                                 

Definition
UDP-glucose pyrophosphorylase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
kse  Kytococcus sedentarius
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:kse00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Ksed_23880
   00052 Galactose metabolism
    Ksed_23880
   00500 Starch and sucrose metabolism
    Ksed_23880
   00520 Amino sugar and nucleotide sugar metabolism
    Ksed_23880
Enzymes [BR:kse01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Ksed_23880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2470686..2471663)
Genome map
AA seq 325 aa AA seqDB search
MRAAVWGAVVGGFPYGEPMNTRRPVRKAVIPVAGLGTRFLPATKAIPKEMLPVVDKPAIQ
YVMEEAVRAGVENVVMVTGRNKGALEDHFDRHWELEKALEKKGDDLRLRRVQKSNEMGAP
HFVRQGEPKGLGHAVLCGRPHVGDEPFAVLLGDDLIGAQDHLLEQMIAVQSERGGSVVAL
MEVPADQVNLYGCAATEGEPDADGVVRITGLVEKPDPADAPSNLAIIGRYVLDPSIFDVL
EQTPPGRGGEIQLTDALEELATASEESGGGVWGVVFRGNRYDTGDRLDYLKAVVRLGRAH
GEFGQEFDGWLREYVQELGQPGRDA
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgcagcggtgtggggagcggttgtcggcggcttcccctacggtgagcccatgaac
acgcgacgtccggtccgcaaggcagtgatccccgtggctgggttgggaactcgtttcctg
cccgccaccaaggccatccccaaggagatgctgccggtggtggacaagcccgctatccag
tacgtgatggaggaggccgtgcgcgcgggggtggagaacgtggtgatggtcaccgggcgc
aacaagggtgcgctggaggaccacttcgaccgtcactgggagctggagaaggccctggag
aagaagggcgacgacctgcgcctgcgtcgagtgcagaagtccaacgagatgggggccccg
cacttcgtgcgccagggggagcccaaggggttgggccacgccgtgctgtgcgggcggccg
cacgtgggggacgagccgttcgctgtgttgctgggtgatgacctcatcggtgcgcaggac
cacctgttggagcagatgatcgcggtgcagtccgagcggggcgggtcggtcgtggcgctg
atggaggtgccggccgaccaggtgaacctgtacggctgtgcggccactgagggcgagccg
gacgctgatggggtggtgcggatcacggggttggtggagaagcccgacccggcggatgcg
cccagcaacctggcgatcatcgggcggtacgtgttggacccgagcatcttcgacgtgctg
gaacagacccctccggggcggggtggggagatccagttgaccgatgcgttggaggagctg
gccactgcctcggaggagtccggtggtggtgtgtggggtgtggtcttccggggcaaccgc
tatgacaccggtgaccggttggactacctgaaggccgtggtgcgtctggggcgcgcgcac
ggtgagttcggccaggagttcgacggttggctgcgcgagtacgtccaggagctgggccag
cccggccgggacgcctga

DBGET integrated database retrieval system