KEGG   Kytococcus sedentarius: Ksed_25940Help
Entry
Ksed_25940        CDS       T00974                                 

Definition
DNA replication and repair protein RecR
Orthology
K06187  
recombination protein RecR
Organism
kse  Kytococcus sedentarius
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:kse00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Ksed_25940
DNA repair and recombination proteins [BR:kse03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Ksed_25940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2665569..2666183)
Genome map
AA seq 204 aa AA seqDB search
MYEGAVQDLIDELNRLPGVGPKSAQRIAFHVLAADAEDVQRLATALQVVKEKVRFCATCG
NVAEAEECRICLDPQRDGTAICVVEEPRDVQAIERTREFRGRYHVLGGAISPLDGIGPDD
LRIAQLMQRLGDGEVTEVIIATDPNMEGEATATYLSRMLQVLEIKVSRLASGLPVGGDLE
YADEVTLGRAFEGRRVVARPGSTP
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
gtgtatgaaggcgcggtccaggacctgatcgacgagctcaaccgcctcccgggggtgggt
cccaagagcgcgcagcgcattgccttccacgtcctggcggccgacgccgaggacgtgcag
cgcctcgcgacggccctgcaggtggtgaaggagaaggtgcgcttctgcgccacctgcggc
aacgtggcggaggccgaggagtgccgcatctgcttggacccgcagcgcgacggcaccgcc
atctgcgtggtggaggagccgcgcgatgtgcaggcgatcgagcgcacccgcgagttccgg
gggcggtaccacgtgctcggcggggcgatcagcccgctggacggcatcgggccggacgac
ctgcgcatcgcccagctcatgcagcggctcggtgacggcgaggtgaccgaggtcatcatc
gccaccgacccgaacatggagggcgaggcgacggccacctacctctcgcggatgctgcag
gtgctggagatcaaggtgagccggctggcctccgggctgcccgtgggcggggacctcgag
tacgccgatgaggtgacgctcggccgcgccttcgaggggcgccgcgtggtcgcccgcccc
gggagcacgccgtga

DBGET integrated database retrieval system