KEGG   Kitasatospora setae: KSE_00010tHelp
Entry
KSE_00010t        CDS       T01648                                 

Gene name
ttrA1
Definition
(GenBank) putative helicase
Organism
ksk  Kitasatospora setae
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NITE: 
UniProt: 
Position
complement(382..2745)
Genome map
AA seq 787 aa AA seqDB search
MVSACGTGKTLIGIRVAEEVGSRRVMVVLPTKDLAVQTALAWRADRRREPMVLISSMDAT
ASASLQAANVGSTGDFTRLASLMKSVEQLTVFVLYDSLRKITEAQQALHAPAFDLAIMDE
AHRISGHHDKQWATVLDNQHIKADRRLFLTATPRIWDSPDLAEDPDNPHRPRPRRRRTTV
QRAPIDPRLINSLDNTHLYGPTVHHYPLHQAVEDGVIADYRILVPTITDTHLHQRLHTDT
TTAASTRAGSAPTTGTRPGNAQTDDMRTGNAKPGGSPAGSALRTTALHLAVHKAMTEHQL
HHVLVYFNEVATARDFTREYPHTLRRLPPELRPATMPSVLHINGDDLPDERQATLNAFTA
APAAILTNAKVLTEGIDSGAIDAVVIADTTRSVVRCVQALGRALRKPAGADKLAHLIIPA
YIPEGADPTDILGTPYEPVWAIATALRSHDHRIAERLPNRANRLPGEVRELVRRRWRFDY
DTHPEVIARAMDLVSFDPARISTRPRLKGLASAQAYRDEHGHLAVPHEYVDPYGFTLGEF
VSGQRSAHQRGELPPEWIAELDALGMIWSVPDAQWQANLTTVTAYHQQTGHLAIPTTDPG
GRFLAEQRAQAARGQLAPERTADLENIDPHWRLLHGPDWHRKYATLRTHLRAGHDPAELH
PDSVLVGIRIGPWLQRQTTGWAKLHPDQQRLLTEIGLTPASSPLPRLARTRRTFRQNTDL
LEAFLVREEGRLPEARESIIVDGEKIAIGAWLAKARSRARSGALRAEDRATITGLLGEEW
AAAPDTA
NT seq 2364 nt NT seq  +upstreamnt  +downstreamnt
gtggtgtccgcgtgcgggacgggcaagacgctgatcggtatccgggtcgccgaggaggtc
ggttcccgccgggtcatggtggtcctgccgacgaaggacctcgccgtgcagaccgccctg
gcctggcgcgcggaccggcgccgcgagccgatggtcctcatctcctcgatggatgccacc
gcgagcgccagcctgcaggcggcgaacgtcggcagtactggtgacttcacccgcctcgcc
tccttgatgaagagcgtcgagcagctgacggtgttcgtcctctacgacagccttcgcaag
atcaccgaagcccaacaggccctgcacgcgcccgcgttcgatctcgcgatcatggacgag
gcccaccggatctcgggtcaccacgacaaacagtgggcaacggtcctcgacaaccagcac
atcaaggccgaccgccgcctgttcctcaccgcgaccccccgcatttgggacagccccgat
ctggccgaggaccccgacaacccccaccgcccccgcccgcggcgacgccgcaccaccgtc
caacgggcgccgatcgaccccaggttgatcaactcactagacaacacccacctctacggc
cccaccgtccaccactaccccctccaccaagcagtcgaagacggcgtcatcgccgactac
cgcatcctcgtccccaccatcaccgacacccacctccaccagcgcctccacaccgacacc
accacagccgccagcacccgggccggcagtgccccgaccaccggcaccaggcccggcaac
gcccagaccgacgacatgaggaccggcaacgccaagccgggcggctccccggccggcagt
gcgctgcgcaccaccgccctgcacctcgccgtccacaaggccatgaccgagcaccaactc
caccacgtcctcgtctacttcaacgaggtcgccaccgcccgcgacttcacccgcgaatac
cctcacaccctgcgccgcctccccccagaactgcgcccggccaccatgccgagcgtcctg
cacatcaacggcgacgacctgcccgacgaacgccaagccaccctgaacgctttcaccgca
gcaccggccgcgatcctcaccaacgccaaggtcctcaccgagggcatcgacagcggagcc
atcgacgccgtcgtcatcgccgacaccacccgcagcgtcgttcgctgcgtccaggccctc
ggccgcgccctgcgcaagcccgccggcgctgacaaactcgcccacctgatcatccccgcc
tacatccccgaaggcgccgaccccaccgacatcctcggcacgccctacgaaccggtctgg
gcgatcgccaccgcgctgcgcagccacgaccaccggatcgccgagcggctgccgaaccgg
gcgaaccggctgccgggggaggtgcgtgaactggtcaggcgccgctggcgcttcgactac
gacacccacccggaggtgatcgctagggcgatggaccttgtctccttcgaccccgcccgc
atcagcaccaggccccgcctcaagggcttggcctccgcccaggcgtaccgcgacgagcac
ggtcacctcgccgtcccgcacgagtacgttgacccctacggcttcacgctgggcgagttc
gtctccggtcagcgcagcgcccaccagcgcggcgagctcccgcccgagtggatcgccgaa
ctcgacgccctcggcatgatctggagcgtccccgacgcccagtggcaggccaacctcacc
accgtcaccgcctaccaccagcagaccggccacctcgccatccccaccaccgaccccggc
ggccgctttctcgccgaacaacgcgcccaggccgcccgcggccaactcgctcccgaacgc
accgccgacctcgagaacatcgacccccactggcgcctgctccacggccccgactggcac
cgcaaatacgcaaccctccgcacccacctgcgcgccggccacgaccccgccgaactccac
cccgacagcgtcctcgtgggcatcaggatcggcccctggctgcaacgccagaccacaggc
tgggccaaactccaccccgaccagcagcgcctgctcaccgagatcggcctcaccccggcc
agcagccccctgccgcggctggcccgcacccgccggaccttccgtcagaacaccgacctc
ctcgaagcgttcctcgtccgtgaggagggtcggctccccgaagcccgcgagagcattatc
gtagacggcgagaagatcgcgatcggtgcctggctcgccaaggccagaagcagagcgcgc
agcggcgccctccgagccgaagaccgggccacgatcaccggtctcctcggtgaggaatgg
gcagccgctccggacaccgcatga

DBGET integrated database retrieval system