KEGG   Kitasatospora setae: KSE_00130tHelp
Entry
KSE_00130t        CDS       T01648                                 

Definition
(GenBank) hypothetical protein
Organism
ksk  Kitasatospora setae
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NITE: 
UniProt: 
Position
21719..22801
Genome map
AA seq 360 aa AA seqDB search
MNDTTRQGTAPAPAGTSPLPGGPFDPGPLTTKEGFRAQARRTYGPPDLQDCAPLGTKVTL
SDPRLVYHGRLLPVVTDDVGAALKQARRLLVKNLTTGNGRGPNFVVDGPRLSGKSLLAAL
IALGFHALVDELYGPDPDRHPVVYINVPHDRSDDLHWSLPFADFLGIEHSRSPETMNHRP
VDMTEPIVRVMQRAGTRLVVVDGVEYIRSSERQTAFDYLLRLQDRLPRVTFLFCGIGARE
IIRAGYGDHRSQAPAAGTHAPRPHIAFPTLWVRPVPYTDAEPEQWHRVLGKVEENLRLYK
HKPGTLRDLAAYLHGRTDGSMHVLDQLICQAAQASILEGTEEIDKDLLDSVLTGYDDPAH
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgacaccacacggcaaggcaccgcacccgcgccggccgggacatccccgctgccg
ggcgggccgttcgatccggggccgctgacgacgaaagagggcttccgggcacaggcccgg
cgcacctacggcccgcccgacctgcaggactgcgctccgctcggcacgaaggtgacgctg
tcggacccacggctggtctatcacggccggctgctgccggtggtgaccgacgatgtgggc
gcagccctgaagcaggcccgcaggttgctggtgaagaacctgacgaccggtaacgggcgc
gggccgaacttcgtcgtcgacggcccgcgcctgagcgggaaatcgttgctggcggcgctg
atcgccctcggattccatgccttggtcgacgagttgtacgggcccgacccggaccggcat
ccggtggtgtacatcaacgtgccgcacgaccgcagcgacgatctgcactggtcgctgccg
ttcgcggacttcctcgggatcgagcactcgcgctctcccgagacgatgaaccatcggccg
gtcgacatgaccgagcccatcgtgcgggtcatgcagcgtgccggcacccggctggtcgtg
gtcgacggtgtcgagtacatcaggagcagcgagcggcagaccgcgttcgactacctcctg
cgtcttcaggacaggctgccccgcgtcacgttcctgttctgcggcatcggtgcgcgggag
atcatcagggcggggtacggcgaccaccggagccaggcaccggccgcgggcacgcacgcg
ccgcggccccacattgccttcccgaccctgtgggtgcggcccgtcccctacaccgacgcc
gagcccgagcagtggcacagggtgctgggcaaggtcgaggagaacctccgcctctacaag
cacaagcccggaaccctgcgcgacctcgccgcctacctccacgggcgtaccgacggctcc
atgcatgtcctggaccagctcatctgccaggctgcccaagccagcatcctggaggggacc
gaggagatcgacaaggacctgctcgactcggtcctgaccggctacgacgaccccgcgcac
tga

DBGET integrated database retrieval system