KEGG   Kitasatospora setae: KSE_00170tHelp
Entry
KSE_00170t        CDS       T01648                                 

Definition
(GenBank) hypothetical protein
Organism
ksk  Kitasatospora setae
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
NITE: 
UniProt: 
Position
complement(29443..29934)
Genome map
AA seq 163 aa AA seqDB search
MKTVSDFLPLLGAPVRQDEGHLIKEIAASWSITLPEDFIAIAGAYGDALISDYLYFCGAR
KLRSYADRMGRMLEATRTVPHAVLPTPGGALVWGNTVEGDQLFLVPRGDGSWTVSAFRRG
WADWHDTDLGFSDWFHLALTGQTATDWLPEWEPLPHPLEPSDE
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgaagaccgtcagcgatttcttgcccttgctcggggctcctgtccggcaggacgaaggg
catctgatcaaggagatcgctgcctcctggtcgatcaccttgcccgaggacttcatcgcg
atcgccggcgcgtacggcgacgcgctgatctcggactacctctacttctgcggggcccgg
aagctccgcagctacgccgaccgcatgggccgcatgctggaggcgacccggacggttccc
cacgcggtgctgccaaccccgggcggtgccctggtctgggggaacacggtcgaaggcgac
cagctgttcctcgttccccgcggggacgggtcctggacggtctcggcgttccgacgtggc
tgggcggactggcacgacactgacctcggcttcagcgactggttccaccttgcgctgacc
ggccagacggccaccgactggctgcccgagtgggagccacttccccacccccttgagccc
agcgacgagtga

DBGET integrated database retrieval system