KEGG   Kitasatospora setae: KSE_00180tHelp
Entry
KSE_00180t        CDS       T01648                                 

Definition
(GenBank) hypothetical protein
Organism
ksk  Kitasatospora setae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ecl1 DUF2116 zf-C6H2 zf-MYND Lar_restr_allev Fer4_9 Zn_Tnp_IS1595 YacG OrfB_Zn_ribbon DUF2256
Motif
Other DBs
NCBI-ProteinID: BAJ25871
NITE: KSE_00180t
UniProt: E4MYX8
Position
30483..30809
Genome map
AA seq 108 aa AA seqDB search
MARVRYCASCGGRLPRGASSRRRYCDDACRAQAYRDRKAEQRRLDFLTLLGQAHYASHRR
LIRALTCPVCGRATMARASRRRDAVYCSGRCRSRAWRQRASRRARSAA
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
gtggcacgtgtccggtactgcgcgagctgcggcggccggctcccccggggagcctcgtcc
cggcgccggtactgcgacgacgcctgccgggcccaggcgtaccgggaccgcaaggcggaa
cagcgccgcctggacttcctgaccctgctcgggcaggcccactacgccagtcaccgacgg
ctgatccgggcgctgacctgtccggtctgtgggcgcgcgaccatggccagggcgagccgg
cggcgcgatgccgtctactgctccggtcggtgccggtcccgcgcctggcgtcagcgggct
tcccgccgagcccggtcggcagcgtga

DBGET integrated database retrieval system