KEGG   Kitasatospora setae: KSE_00190tHelp
Entry
KSE_00190t        CDS       T01648                                 

Definition
(GenBank) hypothetical protein
Organism
ksk  Kitasatospora setae
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
NITE: 
UniProt: 
Position
30921..31289
Genome map
AA seq 122 aa AA seqDB search
MPTWRSLGLICGNANQPQITVGLGEEPVPEGSAGARDGPGRPGVRPRPRFRVGMRLRVGV
RGALDRQEAGAAGGGLAAVVVGRGAGKVEWSTVGHGPSLPRRWAPGPERRPEDGRAAAGP
GE
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
gtgcctacatggcgatcactggggctgatctgcgggaacgccaaccagccccagataacc
gtcgggctcggcgaggaacccgtgcccgaggggtcggcgggcgcgcgggacgggcccgga
cggcccggcgtccggccccggccccggttccgggtcgggatgcggctgcgggtcggggtg
cggggcgcgctcgatcggcaggaggcgggggcggccggcggcggcctggccgccgtcgtc
gtcgggcgcggtgccgggaaggtggagtggtcgacggtcggtcatggacccagtctcccc
cggcgatgggcacccgggcccgaacgccggccggaggacggccgggccgccgccggcccg
ggagaatga

DBGET integrated database retrieval system