KEGG   Kitasatospora setae: KSE_00210tHelp
Entry
KSE_00210t        CDS       T01648                                 

Definition
(GenBank) hypothetical protein
Organism
ksk  Kitasatospora setae
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
NITE: 
UniProt: 
Position
complement(33650..34930)
Genome map
AA seq 426 aa AA seqDB search
MGTDKDPDYEAEDPAFVAAVLALADDMDRWARQVWERIEAKGWNQDRIAVRTPEVSISPT
KASHWKHGSGILHTDRALPTALETRVVAARLELTGREAADLIELGRAIDRACTGLRKQYR
WRQRARKVLGRRAAATDQAAAVPVPVPELQPVLVPEPVPVLGPVVEPEPVSEPVVLPRGL
RRRGPVKGRRSRVRIGAGAAAVAVVVGLIGWYGRSPDVGSAEAAESAGASAPAASGPAAP
LPSGPVASSPAPSTAPPSSRAPSGSAPGSPPSSPSASPTPSPVPSPPASAPASAGVAAAV
PADTGEHCRGPVEAYTDHQASVDVCYRRSGDDLYMIGYIQSAARPLSVDLYLWLKDGSGT
AVYPTDHAVAWTKVTATVPQARREAKIAVKLNPGTTYSVCFLDFPTGSPTPKFNTPGTGR
QVTFVY
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
gtgggaaccgacaaggacccggactacgaggcggaggacccggccttcgtggcggccgta
ctcgcgctcgccgacgacatggaccgctgggcgagacaggtgtgggagcgcatcgaggcc
aaggggtggaatcaggaccggatcgcggtacggacgccggaggtgagcatctccccgacg
aaggcgtcccactggaagcacgggagcgggatcctgcatacggaccgggccctgcccacg
gcgctggagacccgggtggtcgcggcgcgcctggagctcaccggccgggaagcggcggac
ctgatcgagctcggccgcgcgatcgaccgggcctgcaccggactgcgcaagcagtaccgc
tggaggcagcgggcgaggaaggtcctcggccgcagagcagccgccaccgaccaggccgca
gccgtgccggtgccggtgccggagctgcagccggtgctggtgcccgaacccgtgccggtg
ctggggccggtggtcgagcccgagccggtgtccgagccggtcgtcctgccgcgggggctg
cggcgccgggggcccgtcaagggccggcgttcccgggtgaggatcggagccggtgccgcc
gcggtggccgtggtcgtgggcctcatcggctggtacggcaggtctccggacgtcgggtcc
gccgaggccgccgagtcggccggtgcctcggcgcccgccgcctccggcccggccgcgccc
ctcccctccggccccgtcgcgtcgagtccggcgccgtccaccgccccgccgtcgagccgc
gcgccgtccggctcggccccggggagcccaccgtcctcgccgtcggcctccccgactccg
tcgccggtacccagcccgccggcctccgcccccgcctccgcgggcgttgcggccgcggtc
cccgccgacaccggcgagcactgccgcggccccgtggaggcctacaccgaccaccaggca
tcggtcgacgtctgctaccgccgctcgggcgacgacctctacatgatcggctacatccag
tccgccgcccggccgctgagcgtcgacctctacctgtggctgaaggacggcagcggcacc
gccgtctaccccaccgaccacgccgtcgcctggaccaaggtcaccgcgacggtgccccag
gcccgcagggaagcgaagatcgcggtgaagctgaaccccggcacgacgtactccgtctgc
ttcctggacttccccaccgggagcccgaccccgaagttcaacaccccgggcaccggccgg
caggtcaccttcgtctactga

DBGET integrated database retrieval system