KEGG   Kitasatospora setae: KSE_00850tHelp
Entry
KSE_00850t        CDS       T01648                                 

Gene name
galU2
Definition
(GenBank) putative UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ksk  Kitasatospora setae
Pathway
ksk00040  Pentose and glucuronate interconversions
ksk00052  Galactose metabolism
ksk00500  Starch and sucrose metabolism
ksk00520  Amino sugar and nucleotide sugar metabolism
ksk01100  Metabolic pathways
ksk01130  Biosynthesis of antibiotics
Module
ksk_M00362  Nucleotide sugar biosynthesis, prokaryotes
ksk_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ksk00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    KSE_00850t (galU2)
   00052 Galactose metabolism
    KSE_00850t (galU2)
   00500 Starch and sucrose metabolism
    KSE_00850t (galU2)
   00520 Amino sugar and nucleotide sugar metabolism
    KSE_00850t (galU2)
Enzymes [BR:ksk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     KSE_00850t (galU2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2
Motif
Other DBs
NCBI-ProteinID: BAJ25936
NITE: KSE_00850t
UniProt: E4N405
Position
complement(98282..99196)
Genome map
AA seq 304 aa AA seqDB search
MTSTSARIVKAVVPVAGLGTRFLPATKATPKEMLPVVDKPAIQYVVEEAVASGISDVLMV
TGRNKRPLEDHFDRNYELEAELLRKGDTDRLARVCAPTELADIHYVRQGDPRGLGHAVLC
AAPHVGSEPFAVLLGDDLIDPRDPLLSRMIEVREQHGGSVVALMEVDPSQIHLYGCAVVR
HDRDGDTVQVTDLVEKPAPGTAPSNYAVIGRYVLDPAVFEVLRRTEPGRGGEIQLTDALR
ELAHTNEGGPVHGVVFSGRRYDTGDRSDYLKATVRIAWEREDLGPEFRTWLREFMAADVL
APAH
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgacctccacgtctgcccgcatagtcaaggcagtggtacccgtcgccggtctcggaaca
cggttcctgccggccaccaaagccaccccgaaagaaatgctcccggtggtggacaaaccc
gcgatccagtacgtcgtcgaagaggccgtcgcctcggggatatccgacgtcctcatggtc
accggccgcaacaagcgcccgctggaggaccatttcgaccgcaactacgaactcgaggcc
gaactgctcagaaagggcgacaccgaccgcctcgcccgggtctgcgcccccaccgaactc
gcggacatccactacgtgcgccagggcgacccccggggcctgggacacgccgtcctgtgc
gcggccccccacgtcggctcggaacccttcgccgtcctgctcggcgacgacctcatcgac
ccccgcgaccccctgctgagccggatgatcgaggtccgcgagcagcacggcggcagcgtc
gtcgccctgatggaggtcgacccctcccagatccacctctacggctgcgccgtcgtgcgc
cacgaccgcgacggcgacaccgtccaggtcaccgacctggtggagaagcccgcgcccggc
accgccccgagcaactacgcggtgatcggccgctacgtgctggacccggcggtcttcgag
gtcctgcgccgcaccgagcccggccgcggcggcgagatccaactcaccgacgccctgcgc
gaactggcccacaccaacgagggcggcccggtgcacggcgtcgtcttctccggccggcgc
tacgacaccggcgaccgctccgactacctcaaggccaccgtccgcatcgcctgggagcgg
gaggacctgggcccggagttccgcacctggctgcgggagttcatggccgccgacgtcctc
gcacccgcccactga

DBGET integrated database retrieval system