KEGG   Kitasatospora setae: KSE_01600Help
Entry
KSE_01600         CDS       T01648                                 

Definition
putative beta-N-acetylhexosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
ksk  Kitasatospora setae
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:ksk00520]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:ksk00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(187166..188698)
Genome map
AA seq 510 aa AA seqDB search
MILPTPVDLVPAAGRFTLTERTTVRADGGAAAVAELLRTLLRPATGLPLAPGAEGTVVLT
LDPGDRELGEEGYRLTVDPFQVVLHAARPAGLRHAVQTLRQLLPPEALAAGPVSGVEWSL
PAVRITDHPRHAWRGFMIDTARHFQPVERLLAAVDRIALHKLNVLHLHLTDDQGWRLPVD
AYPRLTEVGARRARSMAGHAGSAAYDALPHQGAYTKAELRRLVGYAAERGVTVVPEIDMP
GHTRAALAAYPRLGNQPGRQLDVWTEWGVCETVLGVHEEALEFCRAVLDETLELFPSRYV
HLGGDECPTVEWERSPAARRRAAELGLAAPAQLRGWFLGEVGRHLLAAGRVPVCWAETDG
ATLPVEFTVMPWRDAEHGREAARRGHDVVMAPHRATYLDYPQSARPDEPLGQAGYVVDLA
ATHAHQAAPAHWDEAERARVLGTQAQLWSEFVTTAEHFDYLAYPRLCAIADRAWNPASDY
VRDFLPALAAHRPRLAALGVHHAERALSLT
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
gtgatcctgccgaccccggtcgacctcgttcccgccgccggacggttcaccctgaccgag
cggaccaccgtgcgcgccgacggcggagccgccgccgtcgccgagctgctgcgcacgctg
ctgcgccccgcgaccgggctgccgctggcgcccggtgcggagggcaccgtggtgctgacc
ctcgatcccggggaccgcgagctgggggaggagggctaccggctgacggtggacccgttc
caggtggtgctgcacgcggcccggcccgccggcctgcggcacgcggtgcagacgctgcgc
caactgctgccgcccgaggcactcgcggcgggcccggtgtccggcgtcgagtggagcctg
cccgccgtccggatcaccgaccacccccggcacgcctggcgcggcttcatgatcgacacc
gcccggcacttccagcccgtcgagcggctgctcgccgccgtcgaccggatcgccctgcac
aaactgaacgtgctgcacctgcacctgaccgacgaccagggctggcggctgccggtcgac
gcctacccccggctcaccgaggtcggcgcccgccgggcccgcagcatggccggccacgcc
ggctccgccgcgtacgacgcgctgccgcaccagggcgcgtacaccaaggccgagctgcgc
cgcctggtcgggtacgcggcggagcggggcgtcaccgtcgtccccgagatcgacatgccg
ggccacacccgggccgcgctggccgcctacccgcggctgggcaaccagcccgggcggcag
ctcgacgtgtggaccgagtggggcgtgtgcgagaccgtgctcggcgtgcacgaggaggcg
ctggagttctgccgcgcggtgctggacgagacgctggagctgttcccgtcccggtacgtc
cacctgggcggggacgagtgccccaccgtcgagtgggagcgcagccccgccgcccgccgc
cgggccgccgaactcggcctggccgcccccgcccagctgcgcggctggttcctcggcgag
gtcggccggcacctgctggccgccggacgcgtcccggtctgctgggccgagaccgacggc
gccacgctgcccgtcgagttcaccgtgatgccctggcgggacgccgagcacggccgggag
gccgcccggcgcggccacgacgtggtgatggccccgcaccgcgccacctacctcgactac
ccgcagagcgcccgccccgacgaaccgctcggccaggccgggtacgtcgtcgacctcgcc
gccacgcacgcccaccaggccgcccccgcgcactgggacgaggccgagcgggcccgggtg
ctcggcacccaggcccagctgtggagcgagttcgtcaccaccgccgagcacttcgactac
ctcgcctacccccggctgtgcgccatcgccgaccgggcctggaaccccgccagcgactac
gtccgggacttcctgcccgccctcgccgcgcaccgcccccgcctcgccgcgctcggcgtg
caccacgccgaacgcgccctcagcctcacctga

DBGET integrated database retrieval system