KEGG   Kitasatospora setae: KSE_03380Help
Entry
KSE_03380         CDS       T01648                                 

Definition
(RefSeq) putative glucanase
  KO
K01179  
endoglucanase [EC:3.2.1.4]
Organism
ksk  Kitasatospora setae
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ksk00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    KSE_03380
Enzymes [BR:ksk01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     KSE_03380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(379691..380935)
Genome map
AA seq 414 aa AA seqDB search
MRPPRPVRAALSLAVLLAAGLAAAVPVQAAPAASGSASGSASGSAARTLAPDTRFYVDPA
SKAAQQALTDLKAHDLDGALAMARLASWPVAQWFNGTATPQETTDAMAALQAKAAKAHQV
PVTVAYNVPGRDCSQYSAGGASNSAEYAAWIDALARGIGDRRTVVILEPDGLALSPAFCG
GTAAQQQDRLAEISAAVRRLEQQPGAVVYLDSGHSSWQNVGTQAQLLVDAGVADAQGFFL
NVSNYQTDAALARYGTLVSQCVWYLRNTPGATADSCANQYWPAADADAWYAARVPADAKL
PHFVIDSSRNGQGPWTPEPGKYTGDPQTWCNPPARGLGTRPTADTGRPLLDAFLWIKVPG
ESDGSCTRGTAGPADPEYGSVDPIAGGWWPAQAHSLAANAAPKLGFNTGLLPQH
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgcgcccaccccgccccgtccgagccgcgctgtcgctggccgtgctgctcgccgccggc
ctcgccgccgccgtcccggtccaggccgcgcccgccgcatccggctctgcgtccggctcc
gcgtccggctccgccgcgcggaccctcgcgccggacacccggttctacgtcgacccggcc
agcaaggccgcccagcaggcgctgaccgacctgaaggcgcacgacctggacggcgcgctg
gcgatggcccggctggcgtcctggccggtcgcgcagtggttcaacgggacggcgaccccg
caggagaccaccgacgcgatggccgcgctgcaggcgaaggccgccaaggcccaccaggtg
ccggtcaccgtcgcctacaacgtgccgggccgggactgctcgcagtactcggcgggcggc
gcctccaacagcgccgagtacgcggcctggatcgacgcgctggcccgcggcatcggcgac
cgcaggaccgtcgtcatcctggagccggacggcctcgccctgtcgcccgcgttctgcggc
ggcaccgccgcccagcagcaggaccgcctcgccgagatctccgccgccgtccgccgcctg
gagcagcagcccggcgcggtcgtctacctggactccggccacagcagctggcagaacgtc
ggcacccaggcccaactgctggtcgacgccggagtcgccgacgcgcagggcttcttcctg
aacgtgtcgaactaccagacggacgccgcgctggcccgctacggcaccctggtctcccag
tgcgtctggtacctgcgcaacacccccggcgccaccgccgactcctgcgccaaccagtac
tggcccgccgcggacgccgacgcctggtacgccgcccgggtccccgccgacgccaagctg
ccccacttcgtgatcgacagcagccgcaacggccagggcccctggacgccggaacccggc
aagtacaccggcgacccgcagacctggtgcaacccgcccgcccgcggcctgggcacccgc
cccaccgcggacaccggccggccgctgctcgacgccttcctgtggatcaaggtccccggc
gagtccgacggcagctgcacccgcggcaccgccggcccggccgaccccgagtacggctcg
gtcgacccgatcgcgggcggctggtggcccgcccaggcgcactcgctggcggcgaacgcc
gcgccgaagctcggcttcaacaccggcctgctcccgcagcactga

DBGET integrated database retrieval system