KEGG   Kitasatospora setae: KSE_03380Help
Entry
KSE_03380         CDS       T01648                                 

Definition
putative glucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
ksk  Kitasatospora setae
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ksk00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(379691..380935)
Genome map
AA seq 414 aa AA seqDB search
MRPPRPVRAALSLAVLLAAGLAAAVPVQAAPAASGSASGSASGSAARTLAPDTRFYVDPA
SKAAQQALTDLKAHDLDGALAMARLASWPVAQWFNGTATPQETTDAMAALQAKAAKAHQV
PVTVAYNVPGRDCSQYSAGGASNSAEYAAWIDALARGIGDRRTVVILEPDGLALSPAFCG
GTAAQQQDRLAEISAAVRRLEQQPGAVVYLDSGHSSWQNVGTQAQLLVDAGVADAQGFFL
NVSNYQTDAALARYGTLVSQCVWYLRNTPGATADSCANQYWPAADADAWYAARVPADAKL
PHFVIDSSRNGQGPWTPEPGKYTGDPQTWCNPPARGLGTRPTADTGRPLLDAFLWIKVPG
ESDGSCTRGTAGPADPEYGSVDPIAGGWWPAQAHSLAANAAPKLGFNTGLLPQH
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgcgcccaccccgccccgtccgagccgcgctgtcgctggccgtgctgctcgccgccggc
ctcgccgccgccgtcccggtccaggccgcgcccgccgcatccggctctgcgtccggctcc
gcgtccggctccgccgcgcggaccctcgcgccggacacccggttctacgtcgacccggcc
agcaaggccgcccagcaggcgctgaccgacctgaaggcgcacgacctggacggcgcgctg
gcgatggcccggctggcgtcctggccggtcgcgcagtggttcaacgggacggcgaccccg
caggagaccaccgacgcgatggccgcgctgcaggcgaaggccgccaaggcccaccaggtg
ccggtcaccgtcgcctacaacgtgccgggccgggactgctcgcagtactcggcgggcggc
gcctccaacagcgccgagtacgcggcctggatcgacgcgctggcccgcggcatcggcgac
cgcaggaccgtcgtcatcctggagccggacggcctcgccctgtcgcccgcgttctgcggc
ggcaccgccgcccagcagcaggaccgcctcgccgagatctccgccgccgtccgccgcctg
gagcagcagcccggcgcggtcgtctacctggactccggccacagcagctggcagaacgtc
ggcacccaggcccaactgctggtcgacgccggagtcgccgacgcgcagggcttcttcctg
aacgtgtcgaactaccagacggacgccgcgctggcccgctacggcaccctggtctcccag
tgcgtctggtacctgcgcaacacccccggcgccaccgccgactcctgcgccaaccagtac
tggcccgccgcggacgccgacgcctggtacgccgcccgggtccccgccgacgccaagctg
ccccacttcgtgatcgacagcagccgcaacggccagggcccctggacgccggaacccggc
aagtacaccggcgacccgcagacctggtgcaacccgcccgcccgcggcctgggcacccgc
cccaccgcggacaccggccggccgctgctcgacgccttcctgtggatcaaggtccccggc
gagtccgacggcagctgcacccgcggcaccgccggcccggccgaccccgagtacggctcg
gtcgacccgatcgcgggcggctggtggcccgcccaggcgcactcgctggcggcgaacgcc
gcgccgaagctcggcttcaacaccggcctgctcccgcagcactga

DBGET integrated database retrieval system