KEGG   Kitasatospora setae: KSE_06230Help
Entry
KSE_06230         CDS       T01648                                 

Definition
hypothetical protein
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
ksk  Kitasatospora setae
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ksk00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:ksk00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:ksk00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(689906..691720)
Genome map
AA seq 604 aa AA seqDB search
MTTPALGPVTTPAPGPVTAAVATPADEAVTTAELAPARYAPLLDTVRAAVLADGADTAWT
ATRDPSGLTVLAVHAPGAHVEVRLTLPLGDAAGYWHPGADWRRTPVADWEGRAATSLVKG
LPAGCLHDHSGATLLTFAAADPVRETTLRYGVSEENDSYVVHLHLAPADRVHRVLFAPRA
PSVAAALRPLRAWYAARTAAMPVPEAARLPLWCTWYAYNQRVSAAEVEKQAALAAGLGFG
AAILDDGWQRHGSGRGYAGVGDWRPDEAKFPDLGAHVAAVRATGLRYLAWTAPLLLGPDA
DCHAAWARYAPRPAGVPGAHVLDPRRPEVRAHVVDTCVRLVREHGFDGLKVDFLDEAMVY
ARDGGGDVGAALIGLLTDLRAALEAVRPELLLELRQPYVGPAMAEFGNLLRSFDCPGDTT
ANRIRTLDTGLLAAGGAVHSDPLLWDAGAPVETAARNLISTLHAVPQVSVRLDELPAEHL
DALRFWLARWRELRPQLLDGDVEPGRPDEQYTLVESVADGVRVVDVHTERVVPLDPAAHR
ETVLVNGSAADRVVVEVRGGPVDAEMEVHGPDGRMIGRTRNTLAPGLHGVRVPRMGLARI
RGVQ
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
gtgaccaccccggccctcgggcccgtcaccaccccggcccccgggcccgtcaccgccgcc
gtcgccaccccggccgacgaggccgtgaccaccgccgaactcgccccggcccggtacgcg
ccgctgctcgacaccgtccgggccgccgtcctcgccgacggcgccgacaccgcctggacc
gccacccgcgacccctccggactcaccgtcctggccgtccacgcccccggcgcgcacgtc
gaggtccggctcaccctgccgctcggcgacgccgccggctactggcaccccggcgccgac
tggcgccgcacccccgtcgccgactgggagggccgggccgccaccagcctggtcaagggc
ctgccggccggctgcctgcacgaccactccggcgccaccctgctcaccttcgccgccgcc
gacccggtccgcgagaccaccctgcgctacggcgtctccgaggagaacgacagctacgtc
gtccacctccacctcgcccccgccgaccgcgtccaccgcgtcctgttcgccccgcgcgcc
ccctcggtcgccgccgcgctgcgcccgctgcgcgcctggtacgccgcgcgcaccgccgcg
atgcccgtccccgaggccgcccggctcccgctctggtgcacctggtacgcctacaaccag
cgggtcagcgccgccgaggtggagaagcaggcggcgctcgccgccgggctcggcttcggc
gcggccatcctggacgacggctggcagcggcacggcagcggccgcggctacgccggggtc
ggcgactggcggcccgacgaggccaagttccccgacctcggcgcgcacgtcgccgccgtc
cgcgccaccggcctgcgctacctcgcctggaccgccccgctgctgctcggccccgacgcc
gactgccacgccgcctgggcccggtacgccccccgcccggccggcgtccccggcgcgcac
gtgctcgacccgcgccgccccgaggtgcgcgcgcacgtcgtcgacacctgcgtccggctg
gtccgcgagcacggcttcgacggtctcaaggtcgacttcctggacgaggcgatggtctac
gcccgggacggcggcggagacgtcggcgccgccctgatcggcctgctcaccgacctgcgc
gcggccctcgaagccgtccgccccgagctgctgctcgaactgcgccagccctacgtcggg
cccgcgatggccgagttcggcaacctgctgcgctccttcgactgccccggcgacaccacc
gccaaccggatccgcaccctggacaccggactgctcgccgccggcggcgccgtgcacagc
gacccgctgctctgggacgccggcgcgcccgtcgagaccgccgcccgcaacctgatcagc
accctgcacgccgtcccgcaggtctccgtccggctcgacgaactgcccgccgagcacctc
gacgcgctgcgcttctggctcgcccgctggcgcgagctgcggccccaactgctggacggc
gacgtcgaacccggccgccccgacgagcagtacaccctggtcgagtcggtcgccgacggc
gtccgggtggtcgacgtgcacaccgagcgggtcgtcccgctcgaccccgccgcgcaccgg
gagaccgtgctggtcaacggcagcgccgcggaccgggtggtggtcgaggtccggggcggc
ccggtggacgccgagatggaggtgcacggccccgacggccgtatgatcgggcggacccgg
aacaccctggccccgggcctgcacggcgtgcgggtcccccggatgggactggcccggatc
cggggcgtccagtga

DBGET integrated database retrieval system