KEGG   Kitasatospora setae: KSE_08030Help
Entry
KSE_08030         CDS       T01648                                 

Gene name
phoA
Definition
putative alkaline phosphatase
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
ksk  Kitasatospora setae
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:ksk00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    KSE_08030 (phoA)
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    KSE_08030 (phoA)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    KSE_08030 (phoA)
Enzymes [BR:ksk01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     KSE_08030 (phoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(888449..889987)
Genome map
AA seq 512 aa AA seqDB search
MSNLSRRIFLLGGLTTAGAAALQLGAAAQISAAATPFPFTLGVASGEPDESSVVLWTRLA
PSPTDADGQGGMPNADVAVDWQVSTSETFATLAGSGTVTARYAQAHSVHVLAGGLAPDAE
YYYRFRAQGFVSPVGRTRTAPAPTTVGRDFTMAFASCAHYESGYYTAYRRMADDRPDLIL
HLGDYIYEGGAGTGGVRQHLGGETVSLADYRRRHALYRTDPDLQAAHAIAPWLVVPDDHE
VENNYAGTVRADNSPVLTAAQWTARRTAAYQAYYENMPLRAAAAPAGNSIQLYRRVRWGT
LATFHMLDTRQFRDDQACGDGSKVCADADLATRTITGSAQEAWLLDGLGQRLGTWDLIGQ
QVFFARNVNAAGAMNMDAWDGYRASRARIQQGIVDRAVRNPVVLTGDVHASWGNDLKADY
ADPSSATIGSELVCTSITSGGNGSAATAVPNGALNPHLRFYSDRRGYVRTRITPAQITAD
FRSVATVTEHGAAATTARTFHLHDGQPGLADA
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacctcagtcgccgcatcttcctgctaggcgggctcaccaccgcgggcgccgcc
gcgctccaactcggcgcggcagcgcagatctcggccgccgccacccccttcccgttcacg
ctcggcgtcgcctccggggaaccggacgagagcagcgtggtgctgtggaccaggctggcc
cccagcccgaccgacgcggacggccagggcggcatgcccaacgccgacgtcgccgtcgac
tggcaggtctccaccagcgagaccttcgccaccctggccggctccggcacggtcaccgcc
cgctacgcccaggcccactcggtgcacgtgctggccggcggcctcgcccccgacgccgag
tactactaccggttccgcgcccaggggttcgtctccccggtcggccggacccggaccgcg
cccgccccgaccacggtcgggcgcgacttcacgatggccttcgcctcctgcgcccactac
gagagcggctactacaccgcctaccggcggatggccgacgaccgccccgacctgatcctg
cacctgggcgactacatctacgagggcggcgccggcaccggcggcgtgcgccagcacctc
ggcggcgagaccgtctcgctggccgactaccgccgccgccacgcgctctaccgcaccgac
ccggacctccaggccgcgcacgcgatcgcgccctggctggtcgtcccggacgaccacgag
gtcgagaacaactacgcgggcacggtccgcgccgacaacagccccgtgctgaccgccgcc
cagtggacggcccggcgcaccgccgcctaccaggcgtactacgagaacatgccgctgcgc
gccgccgccgcgcccgccggcaacagcatccagctctaccgccgggtccgctggggcacc
ctcgccaccttccacatgctcgacacccgccagttccgcgacgaccaggcgtgcggcgac
ggcagcaaggtctgcgccgacgccgacctggccacccggacgatcaccggcagcgcccag
gaggcgtggctgctcgacgggctcggccagcgcctcggcacctgggacctgatcggccag
caggtgttcttcgcccgcaacgtcaacgcggccggcgcgatgaacatggacgcctgggac
ggctaccgggccagccgggcccggatccagcagggcatcgtcgaccgggccgtgcgcaac
cccgtcgtcctcaccggcgacgtgcacgcctcctggggcaacgacctgaaggccgactac
gccgacccgtcctcggccaccatcggctccgaactggtctgcacctcgatcaccagcggc
ggcaacggcagcgccgccacggccgtcccgaacggcgcgctcaacccgcacctgcgcttc
tactccgaccggcgcggctacgtccgcacccggatcacccccgcgcagatcaccgccgac
ttccgctcggtggcgaccgtcaccgagcacggcgcggcggccaccaccgcccgcaccttc
cacctccacgacggacaaccgggactggccgatgcgtaa

DBGET integrated database retrieval system