KEGG   Kitasatospora setae: KSE_08070Help
Entry
KSE_08070         CDS       T01648                                 

Definition
putative glycoside hydrolase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
ksk  Kitasatospora setae
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:ksk00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    KSE_08070
  Lipid metabolism
   00561 Glycerolipid metabolism
    KSE_08070
   00600 Sphingolipid metabolism
    KSE_08070
Enzymes [BR:ksk01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     KSE_08070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(894742..896805)
Genome map
AA seq 687 aa AA seqDB search
MGSPRRLVRAFAALALAAPALTAAGLAAPTPAAALGNGLAATPPMGWNSWNTFGPDISQQ
EIVETIDFMSANGLVAAGYDTVTVDDGWSLWHRTDQTDDIVRGTGGAMQLYDDAGNPVSG
TDGTGNDPTSGHLIPRPDTFPSQQWNGKTVNGIEYLANYAHSKGMKFGLYATDTYLTCQM
HPGSLGHEGTDTADFVSWGVDFVKYDDCPYGPAITGPDGHDYGTQGVGKELTRSIYARVQ
TFQRALDAASAAQGRGKVTLSVSAQPVHTGLPYLLDPNDPARTDPVVLAAGTPKYQAPGY
APTGVWCGQVAHLCRIGGDRNSDLNGVLYQGQLRTALEYRGNVRPGSWHDLDMSFAGWQD
PYGLWGTTDTCECHKPFTDDENRTELGILAMTAAPLISGADLRTTQQAQRSGEGVSWSTG
ITDSALAALKNPGMIAIDQDPAGTPATLVGTPPTSATAPLVLRRALADGSTAVLLVNQDP
ANSRTVSVTSAALGLAGEQTATEVWSGERTALGDQLGATLAPHASRLYRITAGAPATGPL
GFVDDGRAHPLAGAETGGVLRAGDGCTAPITSRAVLGGVVPGEPSEQWRFTGNPDGTVRI
TSACTGTALEGSVLAAGNNPGDPAYLLPPSPGNPWQEWRLAQDPTTHYLTVTNAATGLRL
TAAANAPGAEVRTDPATPGAIQRWNLG
NT seq 2064 nt NT seq  +upstreamnt  +downstreamnt
atgggctccccacgccgcctggtccgcgcgttcgccgcgctggccctggccgcccccgcg
ctgaccgccgccggcctcgccgccccgacccccgccgccgcgctcggcaacggcctcgcc
gccaccccgccgatgggctggaactcctggaacaccttcggtcccgacatcagccagcag
gagatcgtcgagaccatcgacttcatgtccgccaacggactggtcgccgccggctacgac
accgtcaccgtcgacgacggctggtcgctctggcaccgcaccgaccagaccgacgacatc
gtgcgcggcaccggcggcgcgatgcagctctacgacgacgccgggaacccggtcagcggc
accgacggcaccgggaacgaccccaccagcggccacctgatcccccggcccgacaccttc
ccgtcccagcagtggaacgggaagaccgtcaacggcatcgagtacctcgcgaactacgcc
cacagcaagggcatgaagttcggcctctacgccaccgacacctacctcacctgccagatg
caccccggcagtctcggccacgagggcaccgacaccgccgacttcgtctcctggggcgtc
gacttcgtcaagtacgacgactgcccctacggccccgccatcaccggcccggacggccac
gactacggcacccagggcgtcggcaaggagctcacccgctccatctacgcccgcgtccag
accttccagcgcgccctggacgccgcgtccgccgcccagggccgcggaaaggtcacgctg
tcggtctccgcgcagcccgtgcacaccggactgccctacctgctcgacccgaacgacccc
gcccgcaccgacccggtcgtgctggccgccgggacgccgaagtaccaggcccccggctac
gcgcccaccggcgtgtggtgcgggcaggtcgcccacctgtgccggatcggcggcgaccgc
aacagcgacctcaacggggtcctgtaccaagggcagttgaggaccgcgctggagtaccgg
ggcaacgtccggcccggcagctggcacgacctcgacatgagcttcgccggctggcaggac
ccgtacggcctgtgggggaccaccgacacctgcgagtgccacaagcccttcaccgacgac
gagaaccgcaccgagctcggcatcctcgcgatgaccgccgccccgctgatctccggcgcc
gacctgcgcaccacccagcaggcgcagcgcagtggggaaggcgtcagctggtccaccggc
atcaccgacagcgcgctcgccgcgctcaagaaccccggcatgatcgccatcgaccaggac
ccggccggcacccccgccaccctggtcggcaccccgcccacctccgccaccgccccgctg
gtgctccggcgcgccctcgcggacggctcgaccgccgtcctgctggtcaaccaggacccc
gccaactcccgtaccgtcagcgtgacttccgccgcgctcgggctggccggcgagcagacc
gccaccgaggtgtggagcggcgagcgcaccgcgctcggcgaccagctcggcgccaccctc
gccccgcacgcctcccggctctaccggatcaccgccggagcccccgccaccgggccgctc
ggcttcgtcgacgacggccgcgcccacccgctggccggcgccgagaccggcggcgtcctg
cgggccggcgacggctgcaccgcgccgatcaccagccgggccgtgctcggcggcgtcgtc
cccggcgaaccgtccgagcagtggcggttcaccggcaaccccgacggcaccgtccggatc
acctccgcctgcaccggcaccgccctggagggcagcgtgctcgccgccggcaacaacccc
ggcgaccccgcctacctgctgccgcccagccccggaaacccctggcaggagtggcggctc
gcccaggacccgaccacccactacctgaccgtcaccaacgccgccaccggcctgcgcctg
accgccgccgccaacgcgcccggcgccgaggtgcgcaccgacccggccaccccgggcgcg
atccagcgctggaacctgggctga

DBGET integrated database retrieval system