KEGG   Kitasatospora setae: KSE_08110Help
Entry
KSE_08110         CDS       T01648                                 

Definition
(GenBank) putative asparagine synthetase
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
ksk  Kitasatospora setae
Pathway
ksk00250  Alanine, aspartate and glutamate metabolism
ksk01100  Metabolic pathways
ksk01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ksk00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    KSE_08110
Enzymes [BR:ksk01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     KSE_08110
Peptidases [BR:ksk01002]
 Cysteine Peptidases
  Family C44
   KSE_08110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asn_synthase GATase_7 GATase_6 DUF3700
Motif
Other DBs
NCBI-ProteinID: BAJ26650
NITE: KSE_08110
UniProt: E4N619
Position
complement(902774..904627)
Genome map
AA seq 617 aa AA seqDB search
MCGITGWVSFDRDLSTEHATLAAMTATMACRGPDAAGVWLDTHVGLGHRRLAVIDLDGGR
QPMAAEHDGRTVLVTTYSGEIYNYRELRAELRSRGHHFRTDSDTEVALRAYLEWGESFVE
RLNGMYAFALWDPRTEELLLVRDRLGVKPLYYWPTADGVLFGSEPKAILAHPEAHAAVDA
EGLAELLAFSKTPGHAVYRGMHELKPGHTLRVRRAGLTERRYWALESYEHTDDLPTTIAT
VRELLDDIVGRQLIADVPLCTLLSGGLDSSVITALAARGLADAGQGPVRSFAVDFARQAE
NFTPDALRPTLDGPYAHALAAHVGADHRDIVLDTADLIDRANRDAVLAARDLPLGLGEGD
TSLYLLFKAVREHSTVALSGESADEVFGGYLWFHDPAAVAHDGFPWMYLIAKGFSSGASR
LGPHSLLEPGLLAALDLPGYRDTRYREALAEVPRLAGEEGHERRMREISHLHLTRFVQQL
LDRKDRTSMAVGLEVRVPFCDHRLVQYVFNTPWAMKNFDGREKSLLRAAARDVLPEAVAQ
RVKSPYPSTQDPRYAEALRGELRTLLADPAAPAHDLLDLTAATTAVADAAGPDLRNAGET
VLLLDGWLRRHRVDLKL
NT seq 1854 nt NT seq  +upstreamnt  +downstreamnt
atgtgcgggatcaccggatgggtctcgttcgaccgggacctgagcaccgaacacgccacc
ctcgccgcgatgaccgccaccatggcctgccgcggccccgacgccgccggcgtctggctc
gacacccacgtcggcctcggccaccgccggctcgccgtcatcgacctcgacggcggccgc
cagccgatggccgccgagcacgacggccgcaccgtcctggtcaccacctacagcggcgag
atctacaactaccgcgaactgcgcgccgaactccgctcgcgcggccaccacttccgcacc
gacagcgacaccgaggtggccctgcgcgcctacctggagtggggcgagtccttcgtcgag
cggctcaacggcatgtacgccttcgcgctctgggacccgcgcaccgaggaactgctgctg
gtccgcgaccggctcggcgtcaaaccgctctactactggcccaccgccgacggcgtgctg
ttcggctccgaacccaaggcgatcctggcccaccccgaggcgcacgccgccgtcgacgcc
gagggcctcgccgaactgctcgccttcagcaagacacccggccacgccgtctaccgcggc
atgcacgagctcaagcccggccacaccctgcgcgtgcgccgcgcgggcctgaccgaacgc
cgctactgggcgctggagtcgtacgagcacaccgacgacctgccgaccaccatcgccacc
gtccgcgaactgctcgacgacatcgtcggccgccagctgatcgccgacgtgccgctctgc
accctgctctccggcggcctcgactcctcggtgatcaccgcgctcgccgcccgcggcctg
gccgacgccggacagggtccggtccgctcgttcgccgtcgacttcgcccgccaggccgag
aacttcacccccgacgcgctgcgccccaccctggacggcccctacgcgcacgcgctcgcc
gcgcacgtcggcgccgaccaccgcgacatcgtgctcgacaccgccgacctgatcgaccgc
gccaaccgggacgccgtcctcgccgcccgcgacctgccgctcggcctcggcgaaggcgac
acctcgctctacctgctgttcaaggccgtccgcgaacactccaccgtcgccctctccggc
gagtccgccgacgaggtgttcggcggctacctgtggttccacgaccccgccgccgtcgcc
cacgacggcttcccctggatgtacctgatcgccaagggcttctccagcggcgccagccgc
ctcggcccgcactcgctgctcgaacccggcctgctcgccgcgctcgacctccccggctac
cgcgacacccgctaccgcgaggcgctcgccgaagtcccccggctcgccggcgaggagggc
cacgaacgccggatgcgcgagatcagccacctgcacctgacccgcttcgtccaacaactg
ctcgaccgcaaggaccgcacctcgatggccgtcggcctggaggtccgcgtcccgttctgc
gaccaccgcctcgtccagtacgtcttcaacaccccctgggcgatgaagaacttcgacggc
cgggagaagtccctgctgcgcgccgccgcccgcgacgtcctccccgaagccgtcgcccaa
cgcgtcaagagcccctacccctccacccaggacccccgctacgccgaggccctgcgcggc
gaactgcgcaccctgctcgccgaccccgccgcccccgcccacgacctgctcgacctcacc
gccgccaccaccgccgtcgccgacgccgccggccccgacctgcgcaacgccggcgagacc
gtcctgctgctggacggctggctgcgccgacaccgggtcgacctgaagctctga

DBGET integrated database retrieval system