KEGG   Kitasatospora setae: KSE_08490Help
Entry
KSE_08490         CDS       T01648                                 

Definition
putative 6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ksk  Kitasatospora setae
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ksk00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    KSE_08490
   01230 Biosynthesis of amino acids
    KSE_08490
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KSE_08490
   00030 Pentose phosphate pathway
    KSE_08490
   00051 Fructose and mannose metabolism
    KSE_08490
   00052 Galactose metabolism
    KSE_08490
  Energy metabolism
   00680 Methane metabolism
    KSE_08490
Enzymes [BR:ksk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     KSE_08490
Protein phosphatases and associated proteins [BR:ksk01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     KSE_08490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
939351..940376
Genome map
AA seq 341 aa AA seqDB search
MRIGVLTSGGDCPGLNAVIRSVVHRGVVDHGDEIIGFEDGWRGLLEGVHRPLTLDSVSGI
LAQGGTILGSSRVQPSHLRDGVERAKQHCADLGIDAVIPIGGEGTLKAAKLMSDAGLPVV
GVPKTIDNDIACTDVTFGFDTAVSVATEALDRLKTTAESHQRVMVVEVMGRHTGWIALNA
GMAAGAHAIIVPERPFHIDKLTEVVRERFDRQKKFAIVVCAEGAKPEPGTMPWEEGTKDM
YGHERFTGIATQLSRELEHRLGKEARPVILGHTQRGGTPTAYDRVLATRFGWHAVEAAHK
GAFGHITALQGTEIKLVPLGEAVAELKTVPAERYKEAETVI
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgcgtattggtgtcctgaccagcggcggtgactgccccggcctgaacgccgtcatccgt
tccgtggtccaccggggggtggtcgaccacggcgacgagatcatcggcttcgaggacggt
tggcgcggtctcctggagggcgtgcaccgtccgctgacgctcgactcggtgagcggcatc
ctcgcccagggcggcacgatcctgggctcctcgcgggtccagcccagccacctgcgcgac
ggcgtggagcgcgccaagcagcactgcgcggacctcggcatcgacgcggtcatcccgatc
ggcggcgagggcaccctgaaggccgcgaagctgatgagcgacgcgggcctgccggtggtc
ggcgtgccgaagaccatcgacaacgacatcgcctgcaccgacgtcaccttcggcttcgac
accgccgtctcggtggccaccgaggcgctggaccggctgaagaccaccgccgagtcgcac
cagcgggtgatggtcgtcgaggtgatgggccggcacaccggctggatcgcgctcaacgcg
ggcatggcggccggtgcgcacgccatcatcgtgccggagcggccgttccacatcgacaag
ctgaccgaggtcgtgcgcgagcgcttcgaccggcagaagaagttcgcgatcgtggtctgc
gccgagggcgcgaagcccgagcccggcaccatgccgtgggaggagggcaccaaggacatg
tacggccacgagcgtttcaccggcatcgccacccagctctcccgcgagctggagcaccgc
ctcggcaaggaggcccgcccggtcatcctcggccacacccagcgcggcggcaccccgacc
gcgtacgaccgcgtcctggccacccgcttcggctggcacgcggtggaggccgcccacaag
ggcgccttcgggcacatcacggcgctgcagggcaccgagatcaagctggtcccgctcggc
gaggccgtggccgagctgaagaccgttccggcggagcgctacaaggaggccgagaccgtc
atctga

DBGET integrated database retrieval system