KEGG   Kitasatospora setae: KSE_10580Help
Entry
KSE_10580         CDS       T01648                                 

Gene name
xylA
Definition
putative xylose isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
ksk  Kitasatospora setae
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ksk00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    KSE_10580 (xylA)
   00051 Fructose and mannose metabolism
    KSE_10580 (xylA)
Enzymes [BR:ksk01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     KSE_10580 (xylA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
1175779..1176945
Genome map
AA seq 388 aa AA seqDB search
MSQLSPTPADKFTFGLWTVGWQGRDPFGDATRPALDPVETVEKLAALGAYGVTFHDDDLV
PFGSSDAEREAIVKRFRTALESTGLRVPMATTNLFTHPVFKDGAFTANDRDVRRYALRKT
IRNIDLAVELGASVYVAWGGREGAEHGASKDVRVALDRLKEAFDLLGDYVTEQGYDLRFA
IEPKPNEPRGDILLPTIGHALAFIDRLERPELVGLNPEVGHEQMAGLNFPHGIAQALWSG
KLFHIDLNGQSGIKYDQDFRFGAGDLRQAFWLVDLLESSDYQGPRHFDFKPPRTEDFAGV
WESAAGNMRNYLLLKERALAFRADPQVQDALRAARLDQLALPTAADGLAALLADRSAFEE
FDVTAAAERGMAFEHLDQLAIEHLLGAR
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgagccagctctcccccacccccgccgacaagttcaccttcggcctgtggacggtcggc
tggcagggccgcgacccgttcggcgacgccacccgcccggccctggacccggtcgagacg
gtcgagaagctggccgccctgggcgcgtacggcgtgaccttccacgacgacgacctggtg
ccgttcggctcctcggacgcggagcgcgaggcgatcgtcaagcgcttccggaccgccctg
gagtccaccggcctgcgggtcccgatggccaccaccaacctgttcacccacccggtcttc
aaggacggcgcgttcaccgccaacgaccgcgacgtgcgccgctacgcgctgcgcaagacc
atccgcaacatcgacctcgcggtcgagctgggcgcgagcgtgtacgtcgcctggggcggc
cgggagggcgcggagcacggcgcgtccaaggacgtccgggtcgccctggaccggctgaag
gaggcgttcgacctgctcggcgactacgtcacggagcagggctacgacctgcgcttcgcg
atcgagccgaagccgaacgagccgcgcggcgacatcctcctccccaccatcggccacgcc
ctcgccttcatcgaccggctggagcgccccgagctggtcggcctcaacccggaggtcggc
cacgagcagatggcgggcctgaacttcccgcacggcatcgcccaggcgctctggtccggc
aagctgttccacatcgacctgaacggccagtccggcatcaagtacgaccaggacttccgg
ttcggcgcgggcgacctgcggcaggcgttctggctggtcgacctgctggagtcgtccgac
taccagggcccgcggcacttcgacttcaagccgccgcgcaccgaggacttcgccggcgtc
tgggagtccgcggccggcaacatgcgcaactacctgctgctcaaggagcgcgccctggcc
ttccgcgccgacccccaggtccaggacgcgctgcgcgccgcccgcctcgaccagctcgcc
ctgccgaccgccgccgacggcctggccgccctgctcgccgaccgctccgccttcgaggag
ttcgacgtcaccgccgccgccgaacgcggcatggccttcgaacacctcgaccagctcgcc
atcgaacacctcctcggcgcccgctga

DBGET integrated database retrieval system