KEGG   Kitasatospora setae: KSE_10900Help
Entry
KSE_10900         CDS       T01648                                 

Definition
putative glutathione peroxidase family protein
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
ksk  Kitasatospora setae
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:ksk00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:ksk00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
1211944..1212447
Genome map
AA seq 167 aa AA seqDB search
MWVMADSLFELPIRTLAGEPSSLEAYRGRVLLLVNVASKCGLTPQYAGLERLQEKYGERG
FTVLGFPCNQFLGQEPGSAEEIQEFCSTTYGVSFPLFEKIDVNGAGRHPLYARLTEAADA
TGEAGDVQWNFEKFLVAADGEVVGRFRPRTEPESAELVAAIEAQLAG
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
gtgtgggtcatggcggattcgctgttcgagctcccgatccggacgctggcgggcgagccc
tcctcgttggaggcgtaccgcggccgggtgctgctgttggtgaacgtggcgtcgaagtgc
gggctgacgccgcagtacgcgggtctggagcgcctgcaggagaagtacggggagcgcggg
ttcacggtgctcgggttcccgtgcaaccagttcctggggcaggagccggggtcggcggag
gagatccaggagttctgctcgaccacgtacggggtgtccttcccgctgttcgagaagatc
gacgtgaacggggcggggcggcacccgctgtacgcccggctgaccgaggcggcggacgcc
accggtgaggcgggggacgtgcagtggaacttcgagaagttcctggtggcggcggacggc
gaggtggtcgggcggttccggccgcggaccgagccggagtcggcggagctggtggccgcg
atcgaggcgcagctggccggctga

DBGET integrated database retrieval system