KEGG   Kitasatospora setae: KSE_11200Help
Entry
KSE_11200         CDS       T01648                                 

Definition
putative sugar kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
ksk  Kitasatospora setae
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ksk00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    KSE_11200
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KSE_11200
   00052 Galactose metabolism
    KSE_11200
   00500 Starch and sucrose metabolism
    KSE_11200
   00520 Amino sugar and nucleotide sugar metabolism
    KSE_11200
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    KSE_11200
   00524 Butirosin and neomycin biosynthesis
    KSE_11200
Enzymes [BR:ksk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     KSE_11200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
1240888..1241898
Genome map
AA seq 336 aa AA seqDB search
MAGTAVTAGPHGPDGPAPDGAGAPGALIAALDIGGTKIAGGLVDEHGVLRHRVRVPTPAT
GDRDELMTAVDHVLDDLSRHPDWLRVRALGIGSAGPVDTARGTVSPVNLPGWREFPLRAE
TARHPAAAHLPIVLGGDAIAMTAAEHWRGAARPYRNALCLVVSTGIGAGIVLDGVLHTGT
TGNAGHLGHITVDFAGRPCPCGSRGCLEGLASGTAIARTATELGWRPGPDGDPTAGAVAR
AAHAGDPLALAAFDRAARALAAGIAATATLVELDAAVIGGGVAQAGSVLFEPLTRHLADY
ATLPFTRHLTLHPALLGTDAGLIGAAALTRPATTHP
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atggccggtaccgccgtcacagccgggcctcacgggcccgacgggcccgcgccggacggt
gccggcgcgcccggggcgctgatcgcggccctcgacatcggcggcaccaagatcgcgggc
gggctggtcgacgagcacggcgtcctgcgccaccgggtgcgggtccccacccccgccacc
ggtgaccgcgacgagttgatgaccgccgtcgaccacgtcctggacgacctctcccgccac
cccgactggctccgcgtccgcgcgctcggcatcggcagcgccgggcccgtcgacaccgcg
cgcggcaccgtcagcccggtgaacctccccggctggcgcgagttcccgctgcgcgcggag
accgcccggcacccggccgccgcccacctgccgatcgtcctcggcggcgacgccatcgcg
atgaccgccgccgagcactggcggggcgcggcccgcccgtaccgcaacgcgctgtgcctg
gtggtctccaccggcatcggcgccgggatcgtcctggacggcgtcctgcacaccggaacc
accggcaacgccggccacctcgggcacatcaccgtcgacttcgccggccgcccctgcccc
tgcggctcgcgcggctgcctcgaagggctcgcctccggcaccgcgatcgcccgcaccgcc
accgaactcggctggcgccccggccccgacggcgaccccaccgcgggcgccgtcgcccgc
gccgcccacgccggcgacccgctcgcgctggccgccttcgaccgggccgcccgcgccctc
gccgccggcatcgccgccaccgcgacgctggtcgaactcgacgccgccgtgatcggcggc
ggggtcgcccaggccggatccgtcctgttcgagccgctgacccggcacctcgccgactac
gcgaccctccccttcacccgccacctcaccctgcaccccgccctcctcggcaccgacgcc
ggcctgatcggcgccgccgccctcacccgccccgccaccacccacccctga

DBGET integrated database retrieval system