KEGG   Kitasatospora setae: KSE_11390Help
Entry
KSE_11390         CDS       T01648                                 

Gene name
xynA2
Definition
putative endo-1,4-beta-xylanase A precursor
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
ksk  Kitasatospora setae
Brite
Enzymes [BR:ksk01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     KSE_11390 (xynA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(1257634..1259100)
Genome map
AA seq 488 aa AA seqDB search
MAAQSHAARRPGRALAALALAAAGGLLAAATVGSGPAGAAGTTLRDLAEAKGSYFGTALT
QSNLNSSTITAIAGAQFDVVTPGNEMKWDTTEPSAGNFNFGPGDQIVSFAKAHSMRVRGH
TLVWHSQLPSWVGNLPANQVQAAMENHVTTEATHYKGQVYSWDVVNEPFNEDGTLRADAF
YNAMGTGYIADALRTAHAADPNAKLYLNDYNIEGLGAKSDAMYQLVSSLKQQGVPIDGVG
FESHFIVGQVPGSLKANIQRFTALGVNVAITELDDRMPVPASAANLAQQATDYAYVVNSC
LAVAGCVGVSQWGVGDPDSWIPDFFSGYGAATMYDANYQPKAAYNAVVTALGGTGSGSPS
PSASASASASSSPSPSTSVPPAGAGCKVSAQVSAWNTGLTENITVTNTGASAVNGWRLAF
TLPGGQTVTNAWNATVSPAGGQVGASNLAYNAAIPAGGSTSFGFQADHTGNAAAATGFTL
NGVACSAG
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atggctgcacagtcgcacgcagcacgccgtcccgggcgagccctcgccgcgctcgccctc
gccgccgccggcggactgctggccgccgccaccgtcggcagcggcccggccggcgccgcc
ggcaccacgctgcgcgacctcgccgaggccaagggcagctacttcggcaccgccctgacc
cagtccaacctgaacagctccaccatcaccgccatcgccggcgcccagttcgacgtggtc
acccccggcaacgagatgaagtgggacaccaccgaaccctccgccgggaacttcaacttc
ggccccggcgaccagatcgtctccttcgccaaggcccacagcatgcgggtccgcggccac
accctggtctggcacagccaactcccctcctgggtcggcaacctgcccgccaaccaggtg
caggccgcgatggagaaccacgtcaccaccgaggccacccactacaagggccaggtctac
tcctgggacgtcgtcaacgagcccttcaacgaggacggcacgctgcgcgccgacgccttc
tacaacgcgatgggcaccggctacatcgccgacgcgctgcgcaccgcgcacgccgccgac
ccgaacgccaagctctacctgaacgactacaacatcgagggcctgggcgcgaagagcgac
gccatgtaccagctggtctcctcgctcaagcagcagggcgtgccgatcgacggcgtcggc
ttcgagagccacttcatcgtcggccaggtgcccggcagcctgaaggccaacatccagcgc
ttcaccgcgctcggcgtgaacgtcgccatcaccgaactcgacgaccggatgcccgtcccg
gccagtgccgccaacctcgcgcagcaggccaccgactacgcctacgtggtcaactcctgc
ctcgcggtggccggttgcgtgggcgtctcgcagtggggcgtcggcgacccggactcctgg
atcccggacttcttctccggctacggcgcggccaccatgtacgacgccaactaccagccg
aaggccgcctacaacgcggtggtgacggcgctcggcggcaccggctccggctcgccgtcc
ccgtccgcttccgcttcggcttcggcgtcctcctcgccctcgccctcgacctcggtgccg
ccggccggggccgggtgcaaggtgagcgcccaggtcagcgcctggaacaccgggctgacc
gagaacatcaccgtcaccaacaccggcgccagcgccgtgaacggctggaggctggccttc
acgctgcccggcgggcagaccgtcaccaacgcctggaacgcgaccgtcagcccggccggc
ggccaggtcggcgccagcaacctggcgtacaacgcggcgatcccggccgggggctccacc
agcttcggcttccaggccgaccacaccgggaacgcggccgccgcgaccggcttcaccctc
aacggggtggcctgctcggcgggttga

DBGET integrated database retrieval system