KEGG   Kitasatospora setae: KSE_13860Help
Entry
KSE_13860         CDS       T01648                                 

Gene name
gmk
Definition
(GenBank) putative guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
ksk  Kitasatospora setae
Pathway
ksk00230  Purine metabolism
ksk01100  Metabolic pathways
Module
ksk_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:ksk00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    KSE_13860 (gmk)
Enzymes [BR:ksk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     KSE_13860 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_16 AAA_18 RsgA_GTPase AAA_22 AAA_29 AAA_33 ABC_tran Thymidylate_kin MMR_HSR1 CbiA AAA_30 AAA_5 AAA_28 Rad17 EFP CPT NTPase_1 RNA_helicase AAA_25 PRK AAA_17 AAA_24 AAA_23
Motif
Other DBs
NCBI-ProteinID: BAJ27214
NITE: KSE_13860
UniProt: E4N7N3
Position
complement(1539835..1540392)
Genome map
AA seq 185 aa AA seqDB search
MSERPRLTVLSGPSGVGKSTVVAHMRKQFPEVWLSVSATTRHPRPGERDGVQYHFVDHEQ
FDKLVANGELLEWAVFAGNRYGTPRQAVLDKLDKGEPVLLEIDLQGARQVKESMPEAQLV
FLAPPSWEELVRRLTGRGTESQDVIDERLAAAKVELAAEAEFDTTLVNTSVEQVAAELLA
LLGVA
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagcgtccgcggctgaccgtgctctccggcccctccggggtcggcaagagcacg
gtcgtcgctcatatgaggaagcagttccccgaggtctggctgtcggtgtcggcgacgacc
cggcacccgcgccccggtgagcgcgacggtgtgcagtaccacttcgtcgaccacgagcag
ttcgacaagctggtggccaacggcgagctgctggagtgggcggtcttcgccgggaaccgg
tacggcacgccgcggcaggcggtgctggacaagctcgacaagggcgagccggtgctgctg
gagatcgacctccagggcgcccggcaggtcaaggagtcgatgccggaggcccagctggtc
ttcctggcaccgccgagctgggaggagctggtgcgccggctcaccggccggggcaccgag
tcgcaggacgtcatcgacgagcggctggcggcggcgaaggtcgagctggcggccgaggcg
gagttcgacacgacgctggtcaacacctccgtcgagcaggtggcggccgaactgctagcc
ttgctcggtgtagcctga

DBGET integrated database retrieval system