KEGG   Kitasatospora setae: KSE_14940Help
Entry
KSE_14940         CDS       T01648                                 

Gene name
rbsK
Definition
putative ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
ksk  Kitasatospora setae
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:ksk00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    KSE_14940 (rbsK)
Enzymes [BR:ksk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     KSE_14940 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
1654353..1655261
Genome map
AA seq 302 aa AA seqDB search
MPSITVVGSVNRDLVLTVEDLPRPGETVLARGFVEGVGGKGANQAVAAARLGSQVRLVAR
VGSDGEPIRRALAAEGVDLDAVLTAPDARTGIASVVVDRLGENTIVVNPGANAVLSVDDL
PQWLARTPGEVVLVQHEVSAEVVAAAVLRARAQGGTVVLNPAPARPVAAEVLAAVDVLVP
NLGELAALLGTGPVSGPAAARELLERAELPCGAVVVTLGADGALIKQPGRPGVHLPAPVV
DAVDTVGAGDTFCGALADALARGADLPAAAARAVRAASLAVTGLGAQSSMPYAEQLDARA
AS
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgccgtccatcaccgtcgtcggttcggtcaaccgggacctcgtcctgaccgtcgaggac
ctgccgcggcccggcgagaccgtgctcgcgcggggcttcgtcgagggcgtcggcggcaag
ggcgccaaccaggccgtcgcggccgcccggctcggttcgcaggtgcggctggtggcccgg
gtcgggtcggacggcgagccgatccgccgggcgctggccgccgagggcgtcgacctggac
gcggtgctgaccgcgccggacgcccggaccgggatcgcctcggtggtggtcgaccggctc
ggcgagaacaccatcgtggtcaaccccggcgccaacgccgtcctctcggtcgacgacctg
ccgcagtggctggcccgcacccccggcgaggtggtgctggtgcagcacgaggtgtccgcc
gaggtggtggccgccgccgtgctgcgggcccgcgcgcagggcggcacggtcgtcctcaac
ccggccccggcccgtccggtggccgccgaggtgctggccgccgtcgacgtcctggtgccc
aacctgggcgagctggccgcgctgctcggcaccgggccggtgtccggcccggccgccgcc
cgcgaactgctggagcgcgccgaactgccgtgcggcgccgtggtggtgacgctcggcgcg
gacggggcgctgatcaagcagccgggccgcccgggcgtccacctgcccgcccccgtggtg
gacgccgtcgacaccgtcggcgccggcgacaccttctgcggcgccctcgccgacgcgctc
gcccgcggcgccgacctgcccgccgccgcggcccgcgccgtccgggcggcctcgctggcg
gtgaccgggctcggcgcccagtcctcgatgccgtacgcggagcagctcgacgcgcgcgcc
gcgtcctga

DBGET integrated database retrieval system