KEGG   Kitasatospora setae: KSE_15480Help
Entry
KSE_15480         CDS       T01648                                 

Definition
putative oxidoreductase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
ksk  Kitasatospora setae
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:ksk00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    KSE_15480
Enzymes [BR:ksk01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     KSE_15480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
1723296..1724786
Genome map
AA seq 496 aa AA seqDB search
MTSEVSETSGVDVAVVGAGIAGLAAAHHLAAAGRSVRVYEGADRVGGRMASSRVDGWLLD
EGAETIAGAGYEATWELIRAVGLPAERVPVIEPGFALWRHGRAHPHLGHPKGLLTGAGLS
WRGRWAWLRFAAELATAWRGFDPDRPETAPSGDATLSEYCAGSAGRRELLAGMLQPLSGH
CFGWRPDDSALAPMAATLLSVGGAGARWMTYRDGMDTLARLLADRLPVELGRRVTAVRER
AGSDGGVLLEFADGTRVTARQAVLAVPAPLALDLRGDDLPADERPYLAAGSYTPMLKTAC
LLDRPLPGPTGASSYALSVPESESRVCAGLILDHLKAEGRAPEGKGLVSVFASPWASPGL
LGESDERIAEVLCAEAERFLPGLRAATVRTLVHRFPLGLPQGAPAAVRERAAFLDRPTRA
VEYAGDWVMLRPSSEGAVRSGKLAARRVLAHAAGSGSVRGAGAAAGAGAGAAAGAGAAAG
AGAAAGAGAGAAGGVR
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgacctcggaagtatcggaaacgtcgggcgtcgacgtcgcggtggtcggggccgggatc
gccggactggccgccgcgcaccacctggccgcggccgggcggtcggtgcgggtctacgag
ggcgcggaccgggtcggcgggcggatggcctccagccgggtggacggctggctgctggac
gagggcgcggagaccatcgccggcgccgggtacgaggcgacctgggagctgatccgggcg
gtcggcctgcccgccgagcgggtgccggtgatcgaacccggcttcgcgctctggcggcac
ggccgggcccacccgcacctcggccaccccaagggcctgctgaccggcgccggactgtcc
tggcggggccgctgggcctggctccggttcgccgccgaactcgccaccgcctggcgcggg
ttcgaccccgaccggccggagaccgcacccagcggggacgccaccctgagcgagtactgc
gccggatcggccggacgacgggaactcctcgccggcatgctgcaaccgctctccggccac
tgcttcggctggcggccggacgactccgcgctcgccccgatggccgccaccctgctctcg
gtcggcggcgccggagcccgctggatgacctaccgggacggcatggacaccctggcccgc
ctgctcgccgaccggctgccggtcgaactcggccgccgggtcaccgccgtccgggagcgg
gccggatccgacggcggcgtgctgctggagttcgccgacggcacccgggtgaccgcccgg
caggccgtgctggcggtgcccgcgccgctcgccctcgacctgcgcggggacgacctgccg
gccgacgaacggccgtacctcgcggccggcagctacacgccgatgctcaagacggcctgc
ctgctggaccggccgctgcccggcccgaccggggcgtccagctacgcgctgtcggtgccg
gagagcgagagccgggtgtgcgccgggctgatcctcgaccacctgaaggccgaagggcgg
gcccccgagggcaagggcctggtcagcgtgttcgcctcgccgtgggcctcccccgggctg
ctcggcgagtcggacgagcggatcgcggaggtgctctgcgccgaggccgagcggttcctg
cccggcctgcgggccgcgaccgtccggaccctggtgcaccgcttcccgctcgggctgccg
cagggcgcgccggccgccgtccgggagcgggccgcgttcctggaccggccgacccgggcc
gtcgagtacgccggggactgggtgatgctccggccgagcagcgaaggggccgtgcggtcc
gggaagttggcggcgcggcgggtgctggcgcacgcggcggggtcggggtcggtccggggc
gcgggcgcggctgcgggcgcgggcgcgggcgcggctgcgggcgcgggcgcggctgcgggc
gcgggcgcggctgcgggcgcgggcgcgggcgcggcggggggtgtccggtga

DBGET integrated database retrieval system