KEGG   Kitasatospora setae: KSE_15660Help
Entry
KSE_15660         CDS       T01648                                 

Gene name
glpK
Definition
putative glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
ksk  Kitasatospora setae
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ksk00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    KSE_15660 (glpK)
Enzymes [BR:ksk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     KSE_15660 (glpK)
Exosome [BR:ksk04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   KSE_15660 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
1743837..1745381
Genome map
AA seq 514 aa AA seqDB search
MTASRTARHIAAIDQGTTSSRCILFDADGRIVAVEQQEHAQLFPQPGWVEHDAAEIWTRV
RSVVRGALERAGLTAADVRAVGITNQRETTVLWDRHTGVPVHHAIVWQDTRTEALCRELG
RNVGQDRFRRETGLPLASYFAGPKIRWLLDHVEGLRERAEAGDVLFGTMDSWLIWNLTGG
VDGGRHVTDVTNASRTLLMNLHTLEWDERIAESIGVPLAMLPEIRSSAEVYGEAVGDLAG
VPVAAALGDQQAALFGQTCFAEGEAKSTYGTGTFLLLNTGEKIVNSYHGLLTTVGFRIGD
RPPVYALEGSIAVTGSLVQWLRDQLGIISTAAEIETLAGTVEDNGGAYVVPAFSGLFAPY
WRSDARGVITGLTRYVTKGHLARAVLEATAWQTREVVDAMEKDSGVTLTALKVDGGMTSN
NLLMQYIADVLDVPVERPYVAETTALGAAYAAGLAVGFWDGLETLRANWHRAAEWTPRMA
ADTREREHRNWLKAVERTMGWIDQDEQQPEQPGA
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccagcaggaccgcccgccacatcgccgcgatcgaccagggcaccacgtccagc
cggtgcatcctgttcgacgcggacggccggatcgtcgccgtcgagcagcaggagcacgcg
cagctcttcccgcagcccggctgggtggagcacgacgcggcggagatctggaccagggtc
cgctcggtggtgcgcggcgcgctggagcgggcggggctgaccgcggcggacgtccgggcg
gtcgggatcaccaaccagcgcgagaccaccgtgctgtgggaccggcacaccggcgtcccg
gtgcaccacgcgatcgtctggcaggacacccgcaccgaggcgctctgccgcgaactgggc
cgcaacgtcggccaggaccggttccgccgggagaccggcctgccgctggccagctacttc
gccgggccgaagatccgctggctgctggaccacgtcgagggcctgcgcgagcgcgccgag
gcgggggacgtgttgttcgggacgatggacagctggctgatctggaacctgaccggcggc
gtggacggcggccggcacgtcaccgacgtcaccaacgcctcccgcacgctgctgatgaac
ctgcacacgctggagtgggacgagcggatcgccgagtcgatcggcgtcccgctcgcgatg
ctgccggagatccgctcctccgccgaggtgtacggcgaggcggtcggcgacctggcgggc
gtgccggtcgcggcggcgctcggcgaccagcaggcggcgctgttcggccagacctgcttc
gccgagggcgaggccaagtcgacgtacggcaccggcacgttcctgctgctgaacaccggc
gagaagatcgtcaactcgtaccacggcctgctcaccacggtcggcttccggatcggcgac
cggccgccggtgtacgcgctggaggggtcgatcgcggtgaccggctcgctggtgcagtgg
ctgcgcgaccagctcggcatcatctcgaccgccgccgagatcgagaccctggcgggcacc
gtcgaggacaacggcggcgcgtacgtggtgcccgcgttctccggcctgttcgcgccgtac
tggcgctccgacgcgcgcggcgtgatcaccgggctgacccggtacgtcaccaaggggcac
ctggcccgggcggtgctggaggcgacggcctggcagacccgcgaggtggtggacgcgatg
gagaaggactccggcgtgacgctgaccgcgctgaaggtcgacggcggcatgacctccaac
aacctgctgatgcagtacatcgccgacgtgctggacgtcccggtcgagcgcccgtacgtg
gccgagacgaccgcgctcggcgcggcctacgcggcgggcctggcggtcggcttctgggac
ggcctggagacgctgcgcgccaactggcaccgggccgccgagtggacgccccggatggcc
gccgacacgcgcgagcgcgagcaccgcaactggttgaaggccgtggagcgcaccatgggc
tggatcgaccaggacgagcagcagcccgagcagcccggggcctga

DBGET integrated database retrieval system