KEGG   Kitasatospora setae: KSE_16740Help
Entry
KSE_16740         CDS       T01648                                 

Definition
(GenBank) putative enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
ksk  Kitasatospora setae
Pathway
ksk00071  Fatty acid degradation
ksk00280  Valine, leucine and isoleucine degradation
ksk00281  Geraniol degradation
ksk00310  Lysine degradation
ksk00360  Phenylalanine metabolism
ksk00362  Benzoate degradation
ksk00380  Tryptophan metabolism
ksk00410  beta-Alanine metabolism
ksk00627  Aminobenzoate degradation
ksk00640  Propanoate metabolism
ksk00650  Butanoate metabolism
ksk00903  Limonene and pinene degradation
ksk00930  Caprolactam degradation
ksk01100  Metabolic pathways
ksk01110  Biosynthesis of secondary metabolites
ksk01120  Microbial metabolism in diverse environments
ksk01130  Biosynthesis of antibiotics
ksk01212  Fatty acid metabolism
Module
ksk_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ksk00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    KSE_16740
   00650 Butanoate metabolism
    KSE_16740
  Lipid metabolism
   00071 Fatty acid degradation
    KSE_16740
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    KSE_16740
   00310 Lysine degradation
    KSE_16740
   00360 Phenylalanine metabolism
    KSE_16740
   00380 Tryptophan metabolism
    KSE_16740
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    KSE_16740
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    KSE_16740
   00281 Geraniol degradation
    KSE_16740
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    KSE_16740
   00627 Aminobenzoate degradation
    KSE_16740
   00930 Caprolactam degradation
    KSE_16740
Enzymes [BR:ksk01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     KSE_16740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: BAJ27499
NITE: KSE_16740
UniProt: E4N8G8
Position
complement(1858926..1859690)
Genome map
AA seq 254 aa AA seqDB search
MTSEAPLVRRTTADAVTTLQLDSPHNRNALSTRLMAELTAGLAAAAADPEVRAVVLGHTG
RVFCAGADLSEATGDDPTVGPRGLVALQRALVDCPKPVIALVDGHVRAGGLGLVGACDLA
VAGPDATFAFTESRLGLAPAVISLPLRPKLDPRAAARYYLTGETFDSAEAARIGLVTEAA
DDSAAELRTVLDAIRLCSPQGLAESKLLANAAVRESFERHTEELVALSAKLFGSEEAQEG
MRAFLEKRPARWVR
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgaccagcgaagcgccactcgtccgccgcaccaccgccgacgccgtcaccaccctccag
ctcgactccccgcacaaccgcaacgccctctccacccggctgatggccgaactcaccgcc
ggactcgccgcggccgccgccgaccccgaggtccgcgccgtcgtcctcggccacaccggc
cgggtgttctgcgccggcgccgacctctccgaggccaccggcgacgaccccaccgtcggc
ccgcgcggcctggtcgccctgcagcgcgccctcgtcgactgccccaagcccgtcatcgcc
ctggtcgacggccacgtccgggccggcggcctcggcctggtcggcgcctgcgacctcgcg
gtggccggccccgacgccaccttcgccttcaccgagtcccggctcggcctcgcccccgcc
gtcatctcgctgccgctgcgccccaagctcgacccgcgcgccgccgcccgctactacctg
accggcgagaccttcgactccgccgaggcggcccggatcggcctggtcaccgaggccgcc
gacgactccgccgccgaactgcgcaccgtcctggacgcgatccggctctgctcgccgcag
ggcctcgccgagtccaaactgctcgccaacgcggccgtccgggagtccttcgaacggcac
accgaggaactggtcgcgctctcggcgaagctgttcggctccgaggaggcgcaggagggc
atgcgcgccttcctggagaagcggcccgcccgctgggtgcgctga

DBGET integrated database retrieval system