KEGG   Kitasatospora setae: KSE_18890Help
Entry
KSE_18890         CDS       T01648                                 

Definition
(GenBank) putative fatty acid oxidation complex subunit alpha
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
ksk  Kitasatospora setae
Pathway
ksk00071  Fatty acid degradation
ksk00280  Valine, leucine and isoleucine degradation
ksk00281  Geraniol degradation
ksk00310  Lysine degradation
ksk00362  Benzoate degradation
ksk00380  Tryptophan metabolism
ksk00410  beta-Alanine metabolism
ksk00640  Propanoate metabolism
ksk00650  Butanoate metabolism
ksk00903  Limonene and pinene degradation
ksk00930  Caprolactam degradation
ksk01040  Biosynthesis of unsaturated fatty acids
ksk01100  Metabolic pathways
ksk01110  Biosynthesis of secondary metabolites
ksk01120  Microbial metabolism in diverse environments
ksk01130  Biosynthesis of antibiotics
ksk01200  Carbon metabolism
ksk01212  Fatty acid metabolism
Module
ksk_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ksk00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    KSE_18890
   00650 Butanoate metabolism
    KSE_18890
  Lipid metabolism
   00071 Fatty acid degradation
    KSE_18890
   01040 Biosynthesis of unsaturated fatty acids
    KSE_18890
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    KSE_18890
   00310 Lysine degradation
    KSE_18890
   00380 Tryptophan metabolism
    KSE_18890
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    KSE_18890
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    KSE_18890
   00281 Geraniol degradation
    KSE_18890
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    KSE_18890
   00930 Caprolactam degradation
    KSE_18890
Enzymes [BR:ksk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     KSE_18890
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     KSE_18890
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     KSE_18890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 ECH_2 3HCDH NAD_binding_2 DAO NAD_binding_8 AlaDh_PNT_C F420_oxidored Pyr_redox_2 NAD_Gly3P_dh_N GIDA
Motif
Other DBs
NCBI-ProteinID: BAJ27713
NITE: KSE_18890
UniProt: E4N932
Position
complement(2095975..2098137)
Genome map
AA seq 720 aa AA seqDB search
MTDVSSPIRWEQDQDGVVTLVLDDPAQSANTMNAAFTDALEGVVERLAATPELTGVIVTS
AKKTFFAGGDLKLLAAARPADAERVFTDSMRIKRALRRLETLGRPVVAAINGAALGGGLE
LALACHHRIALDAPGSRIGLPEVTLGLLPGGGGVVRTVRMLGITDALLKVLLQGQQYRPA
QALEHGLVHEIAATAEEMDAKARAFVAANPTATQPWDAKGYRIPGGTPSTPALAANLPAF
PANLRKQLNGAPYPAPRNILAAAVESSQVDVDTAFAIEARYFTELACGATAKNMIQAFFF
DMQAVNSGASRPGSVAPRQAAKVAVLGAGMMGAGIAYACAKAGLDVLLKDVTPEAAARGK
AYSAGLLDKQVARGRLTAEQRAAFLDRITPTAEAADLAGCDTVIEAVFENPELKHKVFQE
VQHVVAPDALLCSNTSTLPIGLLAEGVDRAADFVGLHFFSPVDKMALVEIVRGPRTGDEA
LARAFDLVRQIGKTPIVVNDSRGFFTSRVIGRFLDEGVAMIGEGLDPSSVEQAAAQAGYP
AKVLALLDELTLTLPRRIRDEARRAVEEAGGSWTPHPGEAVLDRMLDEFDRPGRSGGAGF
YDYADGRRTRLWPGLREHFARPGARIPFEDMKERLLFGEAIDAIRCLDEGVLTSVADANI
GSVLGIGFPAWTGGVLQYVNGYPGGPAGFTARARELAAAYGERFAPPASLVALAEGGGRY
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgtgagcagccccatccgctgggagcaggaccaggacggcgtggtcaccctc
gtcctcgacgacccggcccagtccgccaacaccatgaacgccgcgttcaccgacgcgctg
gagggagtcgtcgaacggctcgccgccacgcccgagttgaccggcgtcatcgtcacctcg
gcgaagaagaccttcttcgccggcggcgacctcaagctcctcgccgccgcccgacccgcc
gacgccgaacgggtgttcaccgactcgatgcggatcaagcgggcgctgcgccggctggag
acgctcggccggccggtggtcgccgcgatcaacggcgcggcgctcggcggcggcctggaa
ctcgcgctggcctgccaccaccggatcgcgctggacgcccccggcagccggatcggcctg
cccgaggtcaccctcggcctgctgcccggcggcggcggcgtcgtccgcacggtccggatg
ctcggcatcaccgacgccctgctcaaggtgctcctgcaagggcagcagtaccgtccggcg
caggccctggagcacggcctggtgcacgaaatcgccgccaccgccgaggagatggacgcc
aaggcgcgcgccttcgtcgccgcgaacccgaccgccacccagccctgggacgccaagggg
taccggatccccggcggcacgcccagcacccccgcgctggccgccaacctgcccgccttc
cccgccaacctgcgcaagcagctgaacggcgcgccctacccggcgccgcgcaacatcctg
gcggcggccgtggagagcagccaggtcgacgtggacaccgcgttcgcgatcgaggcccgc
tacttcaccgaactggcctgcggcgccaccgcgaagaacatgatccaggcgttcttcttc
gacatgcaggccgtcaactccggtgcctcccgcccgggttcggtcgccccccggcaggcc
gcgaaggtcgcggtgctgggcgcgggcatgatgggcgcgggcatcgcgtacgcctgcgcc
aaggccggcctcgacgtcctgctgaaggacgtcaccccggaggccgccgcccgcggaaag
gcgtacagcgcgggcctgttggacaagcaggtggcgcgcggccggctgaccgccgagcag
cgggccgccttcctcgaccggatcacccccaccgccgaggccgccgacctggccggctgc
gacaccgtcatcgaggcggtcttcgagaaccccgagctcaagcacaaggtgttccaggag
gtccagcacgtcgtcgcgcccgacgcgctgctctgctccaacacctccaccctgccgatc
ggcctgctcgccgaaggcgtcgaccgggccgccgacttcgtcggcctgcacttcttctcg
ccggtcgacaagatggcgctggtcgagatcgtccgcggcccgcgcaccggcgacgaggcg
ctggcccgggccttcgacctggtccggcagatcggcaagaccccgatcgtggtcaacgac
tcccgcggcttcttcacctcccgggtgatcggccggttcctcgacgagggcgtcgcgatg
atcggcgagggcctcgacccgtcctccgtcgaacaggccgccgcccaggccggctacccc
gccaaggtcctcgcgctgctggacgagctcaccctcaccctgccgcgccggatccgcgac
gaggcccgccgcgccgtcgaggaggccggcggcagctggaccccgcaccccggcgaggcc
gtcctggaccggatgctcgacgagttcgaccgccccggccgcagcggcggcgccggcttc
tacgactacgccgacggccgccgcacccggctctggcccggcctgcgcgagcacttcgcc
cgcccgggcgcgcggatcccgttcgaggacatgaaggagcggctgctgttcggcgaggcg
atcgacgcgatccgctgcctcgacgagggcgtcctcacctcggtcgccgacgccaacatc
ggctccgtcctcggcatcggcttccccgcctggaccggcggcgtcctccagtacgtcaac
ggctaccccggcggcccggccggcttcaccgcccgcgcccgggaactcgccgccgcctac
ggcgagcgcttcgccccgcccgcctcgctggtcgccctcgccgagggcggcggccgctac
tga

DBGET integrated database retrieval system