KEGG   Kitasatospora setae: KSE_20490Help
Entry
KSE_20490         CDS       T01648                                 

Gene name
trpA
Definition
(GenBank) putative tryptophan synthase alpha chain
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ksk  Kitasatospora setae
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ksk00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    KSE_20490 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    KSE_20490 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    KSE_20490 (trpA)
Enzymes [BR:ksk01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     KSE_20490 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NITE: 
UniProt: 
Position
complement(2285172..2285981)
Genome map
AA seq 269 aa AA seqDB search
MADTKLTTTLAATKAAGRAALIGYLPAGFPTVDGGTAAIKALIEGGCDVVEVGLPHSDPV
LDGAVIQTADDIALRGGVKIKDVLATVAEVAAAHPAVPVLVMTYWNPVDRYGVARFAADL
AAAGGAGCILPDLPYEESVEWRKAAEEHGLDTVFVVAPSSTDHRLAEVTAAGSGFVYAAA
VMGVTGTRAAVGNLAEDLVARTRATTSLPVCVGLGVSDADQAAEVAGFADGVIVGSAFVK
RLLEADEPAAGLAAVRALAAELAEGVRRK
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atggccgacaccaagctcaccaccaccctggccgccaccaaggcggcgggccgggcggcc
ctgatcggctacctgccggccggcttcccgaccgtggacggcggcaccgccgcgatcaag
gccctgatcgagggcggctgcgacgtggtcgaggtcggcctgccgcactccgacccggtg
ctggacggcgcggtcatccagaccgcggacgacatcgcgctgcgcggcggcgtgaagatc
aaggacgtgctggccaccgtcgccgaggtggcggcggcccacccggccgtcccggtcctg
gtgatgacgtactggaacccggtcgaccgctacggggtggcccggttcgccgccgacctg
gcggcggccggcggcgcgggctgcatcctgcccgacctgccgtacgaggagtcggtggag
tggcgcaaggccgccgaggagcacggtctggacaccgtgttcgtggtcgccccgtcctcg
accgaccaccggctggccgaggtcaccgcggcgggctccggcttcgtctacgcggcggcc
gtgatgggcgtcaccggcacccgcgccgcggtcggcaacctggccgaggacctggtggcc
cgcacccgcgccaccacctcgctgccggtctgcgtcggcctgggcgtctccgacgccgac
caggccgccgaggtggccggcttcgcggacggcgtgatcgtcggctcggcgttcgtcaag
cgcctgctggaggccgacgagccggcggccggcctggccgccgtccgggcgctcgcggcc
gagctggcggagggcgtccgccgcaagtag

DBGET integrated database retrieval system