KEGG   Kitasatospora setae: KSE_20500Help
Entry
KSE_20500         CDS       T01648                                 

Gene name
trpB1
Definition
(GenBank) putative tryptophan synthase beta chain
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ksk  Kitasatospora setae
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ksk00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    KSE_20500 (trpB1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    KSE_20500 (trpB1)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    KSE_20500 (trpB1)
Enzymes [BR:ksk01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     KSE_20500 (trpB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NITE: 
UniProt: 
Position
complement(2285983..2287215)
Genome map
AA seq 410 aa AA seqDB search
MSEHYLPGAQVPDARGYFGAYGGRFIPEALVAAVEQVAEEYEKAKNDPAFAAELDVLLKD
YTGRPSPLTDVHRFSAEAGGARVLLKREDLNHTGSHKINNVLGQALLTRRMGKTRIIAET
GAGQHGVATATACALFGFDCTIYMGEVDTKRQALNVARMRMLGAEVIPVTSGSRTLKDAI
NEAFRDWVANVDSTHYLFGTVAGPHPFPMMVRDLHRVIGVEARQQVLDRTGKLPDAVVAC
VGGGSNAMGIFHEFIPDAGVRLIGCEAAGDGAETPKHAATLTKGDPGVLHGSRTYVLQDE
DGQTIESHSISAGLDYPGVGPEHAWLKDTGRAEYRPVTDAQAMEALRLLSRTEGIIPAIE
SAHALAGALELGRELGPEATILVSLSGRGDKDMHTAAEYFGLYDDAEGTN
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgtccgagcactacctcccgggcgcccaggtgcccgacgcccgcggctacttcggcgcc
tacggcggccgcttcatcccggaggcgctggtcgccgccgtcgagcaggtcgccgaggag
tacgagaaggccaagaacgacccggcgttcgccgccgaactggacgtcctgctcaaggac
tacaccggtcggccgagcccgctgaccgacgtccaccggttctccgcggaggccggcggg
gcgcgggtcctgctcaagcgcgaggacctcaaccacaccggctcgcacaagatcaacaac
gtgctgggccaggcgctgctgacccgccggatgggcaagacccggatcatcgccgagacc
ggcgccggccagcacggcgtggccaccgccaccgcctgcgcgctgttcggcttcgactgc
accatctacatgggcgaggtcgacaccaagcgccaggcgctgaacgtcgcccggatgcgg
atgctgggcgccgaggtgatcccggtgacctccggcagccgcaccctgaaggacgccatc
aacgaggcgttccgcgactgggtcgccaacgtcgactccacccactacctgttcggcacg
gtggccggcccgcacccgttcccgatgatggtgcgcgacctgcaccgggtgatcggcgtc
gaggcccgccagcaggtgctggaccgcaccgggaagctcccggacgcggtggtcgcctgc
gtcggcggcggctccaacgcgatgggcatcttccacgagttcatcccggacgcgggcgtc
cggctgatcggctgcgaggcggccggcgacggcgccgagacccccaagcacgccgccacc
ctgaccaagggcgacccgggcgtgctgcacggctcgcgcacctacgtcctgcaggacgag
gacggccagaccatcgagtcgcactcgatctcggccggcctggactacccgggcgtcggc
ccggagcacgcctggctgaaggacaccggacgggccgagtaccgcccggtgaccgacgcg
caggcgatggaggcgctgcggctgctgtcccgcaccgagggcatcatcccggccatcgag
tccgcgcacgcgctggccggcgcgctcgaactcggccgcgagctcggcccggaggcgacc
atcctggtctcgctctccggccgcggggacaaggacatgcacaccgccgccgagtacttc
ggcctctacgacgacgccgaggggaccaactga

DBGET integrated database retrieval system