KEGG   Kitasatospora setae: KSE_20500Help
Entry
KSE_20500         CDS       T01648                                 

Gene name
trpB1
Definition
putative tryptophan synthase beta chain
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ksk  Kitasatospora setae
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ksk00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    KSE_20500 (trpB1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    KSE_20500 (trpB1)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    KSE_20500 (trpB1)
Enzymes [BR:ksk01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     KSE_20500 (trpB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(2285983..2287215)
Genome map
AA seq 410 aa AA seqDB search
MSEHYLPGAQVPDARGYFGAYGGRFIPEALVAAVEQVAEEYEKAKNDPAFAAELDVLLKD
YTGRPSPLTDVHRFSAEAGGARVLLKREDLNHTGSHKINNVLGQALLTRRMGKTRIIAET
GAGQHGVATATACALFGFDCTIYMGEVDTKRQALNVARMRMLGAEVIPVTSGSRTLKDAI
NEAFRDWVANVDSTHYLFGTVAGPHPFPMMVRDLHRVIGVEARQQVLDRTGKLPDAVVAC
VGGGSNAMGIFHEFIPDAGVRLIGCEAAGDGAETPKHAATLTKGDPGVLHGSRTYVLQDE
DGQTIESHSISAGLDYPGVGPEHAWLKDTGRAEYRPVTDAQAMEALRLLSRTEGIIPAIE
SAHALAGALELGRELGPEATILVSLSGRGDKDMHTAAEYFGLYDDAEGTN
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgtccgagcactacctcccgggcgcccaggtgcccgacgcccgcggctacttcggcgcc
tacggcggccgcttcatcccggaggcgctggtcgccgccgtcgagcaggtcgccgaggag
tacgagaaggccaagaacgacccggcgttcgccgccgaactggacgtcctgctcaaggac
tacaccggtcggccgagcccgctgaccgacgtccaccggttctccgcggaggccggcggg
gcgcgggtcctgctcaagcgcgaggacctcaaccacaccggctcgcacaagatcaacaac
gtgctgggccaggcgctgctgacccgccggatgggcaagacccggatcatcgccgagacc
ggcgccggccagcacggcgtggccaccgccaccgcctgcgcgctgttcggcttcgactgc
accatctacatgggcgaggtcgacaccaagcgccaggcgctgaacgtcgcccggatgcgg
atgctgggcgccgaggtgatcccggtgacctccggcagccgcaccctgaaggacgccatc
aacgaggcgttccgcgactgggtcgccaacgtcgactccacccactacctgttcggcacg
gtggccggcccgcacccgttcccgatgatggtgcgcgacctgcaccgggtgatcggcgtc
gaggcccgccagcaggtgctggaccgcaccgggaagctcccggacgcggtggtcgcctgc
gtcggcggcggctccaacgcgatgggcatcttccacgagttcatcccggacgcgggcgtc
cggctgatcggctgcgaggcggccggcgacggcgccgagacccccaagcacgccgccacc
ctgaccaagggcgacccgggcgtgctgcacggctcgcgcacctacgtcctgcaggacgag
gacggccagaccatcgagtcgcactcgatctcggccggcctggactacccgggcgtcggc
ccggagcacgcctggctgaaggacaccggacgggccgagtaccgcccggtgaccgacgcg
caggcgatggaggcgctgcggctgctgtcccgcaccgagggcatcatcccggccatcgag
tccgcgcacgcgctggccggcgcgctcgaactcggccgcgagctcggcccggaggcgacc
atcctggtctcgctctccggccgcggggacaaggacatgcacaccgccgccgagtacttc
ggcctctacgacgacgccgaggggaccaactga

DBGET integrated database retrieval system