KEGG   Kitasatospora setae: KSE_20510Help
Entry
KSE_20510         CDS       T01648                                 

Gene name
trpC
Definition
(GenBank) putative indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
ksk  Kitasatospora setae
Pathway
ksk00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ksk01100  Metabolic pathways
ksk01110  Biosynthesis of secondary metabolites
ksk01130  Biosynthesis of antibiotics
ksk01230  Biosynthesis of amino acids
Module
ksk_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ksk00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    KSE_20510 (trpC)
Enzymes [BR:ksk01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     KSE_20510 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS FMN_dh AIP3
Motif
Other DBs
NCBI-ProteinID: BAJ27874
NITE: KSE_20510
UniProt: E4N9J3
Position
complement(2287431..2288237)
Genome map
AA seq 268 aa AA seqDB search
MLDEIIDGVREDLAERQARVSLDELKELAAKAPEAKDGVAALRGDGVRVICEVKRSSPSK
GALAAIADPAALAADYAAGGAAAISVLTEQRRFGGSLADLDAVRAAVPTPVLRKDFIVTA
YQLWEARAHGADLALLIVAALDQPALVSLIERAESIGLTPLVEVHDEEEIARAVDAGARI
IGVNARDLKTLQVDRNTFGNVVDAIPAHIVKVAESGVRGPHDLITYANQGADAVLVGESL
VTGRDPKAAVADLVAAGAHPALRNNGRG
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
gtgctcgacgagatcatcgacggggtccgggaggacctcgccgagcggcaggcccgggtc
tccctggacgagctcaaggagctcgccgcgaaggcgcccgaggcgaaggacggcgtggcc
gcgctgcgcggtgacggcgtccgggtgatctgcgaggtcaagcgctccagcccgtccaag
ggcgcgttggcggcgatcgccgacccggccgcgctggcggccgactacgcggccggcggt
gccgccgcgatcagcgtgctcaccgagcagcgccgcttcggcggttcgctggccgacctg
gacgcggtgcgcgccgcggtgcccaccccggtcctgcgcaaggacttcatcgtcaccgcc
taccagctgtgggaggcccgcgcgcacggcgcggacctggcgctgctgatcgtcgccgcg
ctggaccagccggccctggtctcgctgatcgagcgggccgagtcgatcggactgaccccg
ctggtcgaggtgcacgacgaggaggagatcgcccgcgcggtggacgccggcgcccggatc
atcggcgtcaacgcccgcgacctgaagaccctccaggtcgaccggaacaccttcggcaac
gtggtggacgccatcccggcgcacatcgtcaaggtcgccgagtcgggcgtgcgcgggccg
cacgacctgatcacctacgccaaccagggcgccgacgcggtgctggtcggcgagtccctg
gtcaccggccgggacccgaaggccgcggtcgccgacctggtcgcggccggcgcccacccg
gcgctgcgcaacaacgggcggggctga

DBGET integrated database retrieval system