KEGG   Kitasatospora setae: KSE_20940Help
Entry
KSE_20940         CDS       T01648                                 

Definition
(GenBank) putative sugar kinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
ksk  Kitasatospora setae
Pathway
ksk00010  Glycolysis / Gluconeogenesis
ksk00052  Galactose metabolism
ksk00500  Starch and sucrose metabolism
ksk00520  Amino sugar and nucleotide sugar metabolism
ksk00521  Streptomycin biosynthesis
ksk01100  Metabolic pathways
ksk01110  Biosynthesis of secondary metabolites
ksk01120  Microbial metabolism in diverse environments
ksk01130  Biosynthesis of antibiotics
ksk01200  Carbon metabolism
Module
ksk_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ksk00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KSE_20940
   00052 Galactose metabolism
    KSE_20940
   00500 Starch and sucrose metabolism
    KSE_20940
   00520 Amino sugar and nucleotide sugar metabolism
    KSE_20940
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    KSE_20940
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    KSE_20940
Enzymes [BR:ksk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     KSE_20940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: BAJ27917
NITE: KSE_20940
UniProt: E4N9N6
Position
complement(2329752..2330645)
Genome map
AA seq 297 aa AA seqDB search
MPARFGADVGGTSVRAALVGADGALLTPLLDLPRSPDLIGQLADLYAESAERAGSSVTVV
GAGLAIPGAVDPATGRIGSVPTAPALRGLDPAEVRLAPGLPLGVCNDANAAVLAERAYGA
ARGARHVVGLFVGTGVGGGVVVDGALLTGRAGLAAEIGHLVVDPDGPPCPCGGRGCLEQY
ASGTAIAAAYTAATGRSVTGAAEVALAARAGDPQARAAYAGAGRLLGVAAAGLANLFNPE
AVVLGGGVAAVWDLFGDDLVRAVERHTMPLTRRGLRVAPGRLGRAAGVLGAALAATG
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
gtgcccgcccggttcggggcggacgtcggcggcaccagcgtgcgggccgcactggtcggc
gccgacggggccctgctgaccccgctgctcgacctgccccgctcacccgacctgatcggc
caactcgccgacctgtacgccgagtcggccgagcgggccggctcctccgtcacggtggtc
ggggccgggttggcgatccccggggcggtcgatccggccaccggccggatcggatcggtc
ccgaccgcgccggccctgcgcgggctcgacccggcggaggtacggctcgcccccgggctt
ccgctcggcgtctgcaacgacgccaacgcggcggtcctggccgagcgggcgtacggcgcc
gcccggggcgcccggcacgtggtgggcctgttcgtcgggaccggagtgggcggcggcgtc
gtcgtcgacggagccctgctcaccggccgggccggactggccgccgagatcggccacctg
gtggtcgacccggacggtccgccctgcccgtgcggcggacggggctgcctggagcagtac
gcgtcgggcaccgcgatcgccgccgcgtacaccgcggccaccggccggtccgtgaccggg
gccgccgaggtcgccctggccgcccgggccggcgacccgcaggcccgggccgcgtacgcc
ggggcgggccgcctgctcggggtcgccgcggcgggcctggccaacctcttcaaccccgag
gccgtggtgctggggggcggcgtggccgcggtctgggacctcttcggggacgacctcgtc
cgggccgtcgagcgccacaccatgccgctcaccaggcgcggcctgcgcgtcgcccccggg
cggctcgggcgcgcggccggcgtcctgggggccgccctggccgccaccggctga

DBGET integrated database retrieval system