KEGG   Kitasatospora setae: KSE_21280Help
Entry
KSE_21280         CDS       T01648                                 

Gene name
murE
Definition
putative UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
ksk  Kitasatospora setae
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:ksk00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:ksk00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(2368399..2369943)
Genome map
AA seq 514 aa AA seqDB search
MPKSDQISASPPRPDRTAALPLAEAARLLGLAGVEGPEVTGVTHDSRAVRPGDVYVAFPG
ANHHGAAFAAGAAAAGAVAVLTDAAGAELAAAAGVPLLVVDSPREAMGPLAAAVYGAPSE
RMLMIGLTGTNGKTTTSYLVEGGLRGAGRLPGVIGTVEMRVGEERIKSERTTPEATELHA
VLAVMREAGADAVVMEVSSHALVYGRTDGVVYDVALFNNLTPEHLDFHPDMEDYYRAKAR
LFQQGKSRRGVANRDDSYGRRLAGEARIPMTTFSAAGDPAADWRAVDVRPGPSGSTFRVL
GPNGEQADAAVPLPGLFNVSNALGAITALVVAGVELADAVAGVAAVPGVPGRLEEVDAGQ
DYVAVVDYAHKPDALSSVLASLREVTKGRLHVVVGCGGDRDPYKRGPMGAIAARLADTAV
LTSDNPRSEDALAILATMLSGAAEVPEQERGEVLAVPDRGEAIALAVSRAHSGDTVLVAG
KGHELGQYVKGEVRPFDDRQVLRTAIEQIMEVDR
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
gtgccgaaatccgatcaaatctccgcgagcccgccccgacccgaccgcaccgcggcgctg
ccgctcgccgaggcggcccggctgctcgggctggccggcgtcgagggccccgaggtcacc
ggcgtcacccacgactcccgggcggtgcggcccggcgacgtgtacgtggccttccccggc
gccaaccaccacggcgcggcgttcgccgccggggccgccgccgcgggcgcggtcgcggtg
ctcaccgacgccgccggggccgaactggccgccgccgcgggcgtcccgctgctggtcgtc
gacagcccgcgggaggcgatgggcccgctggccgccgccgtctacggagcgcccagcgag
cggatgctgatgatcggtctgaccggcaccaacggcaagaccaccacctcctacctggtg
gagggcggcctgcgcggggccggccggctgcccggcgtgatcggcaccgtcgagatgcgg
gtcggcgaggagcggatcaagtccgagcggaccacccccgaggccaccgaactgcacgcg
gtgctcgccgtgatgcgcgaggccggcgcggacgcggtggtgatggaggtctccagccac
gcgctggtctacggccgcaccgacggcgtggtctacgacgtcgcgctgttcaacaacctg
acgcccgagcacctcgacttccaccccgacatggaggactactaccgggccaaggcccgg
ctcttccagcagggcaagtcccgccgcggcgtcgccaaccgggacgactcctacggccgc
cggctggccggcgaggcccggatcccgatgaccaccttctcggcggccggcgacccggcc
gccgactggcgcgccgtcgacgtccggcccggcccgtccggctcgaccttccgggtgctc
ggcccgaacggcgaacaggccgacgccgcggtgccgctgcccggcctgttcaacgtctcc
aacgcgctcggcgcgatcaccgcgctggtggtcgccggcgtcgaactggccgacgcggtg
gccggggtggccgccgtccccggcgtccccggccggctggaggaggtcgacgcggggcag
gactacgtcgccgtggtcgactacgcgcacaagccggacgcgctcagctcggtgctcgcc
tcgctccgcgaggtcaccaagggccggctgcacgtggtcgtcggctgcggcggcgaccgc
gacccgtacaagcgcgggccgatgggcgcgatcgccgcccggctcgccgacaccgccgtc
ctcaccagcgacaacccgcgctccgaggacgcgctggcgatcctcgccaccatgctctcc
ggcgccgccgaggtgcccgagcaggagcgcggcgaggtcctcgccgtccccgaccgcggc
gaggcgatcgccctcgcggtctcccgcgcgcacagcggcgacaccgtgctggtcgcgggc
aagggccacgagctgggccagtacgtgaagggcgaggtccgcccgttcgacgaccgccag
gtcctgcggaccgcgatcgagcagatcatggaggtagaccggtga

DBGET integrated database retrieval system