KEGG   Kitasatospora setae: KSE_21630Help
Entry
KSE_21630         CDS       T01648                                 

Definition
putative esterase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
ksk  Kitasatospora setae
Brite
Enzymes [BR:ksk01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     KSE_21630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
2404545..2405327
Genome map
AA seq 260 aa AA seqDB search
MPLLPGAEPFRRSGGPVGVLLVHGFTGSPQSMRPWAEHLADAGLTVSAPLLPGHGTRWQD
LQPTRWEDWYATAEAAFEELAAECAQVFVCALSMGGSLALRLAAKHGGRVSGLVLVNPSV
RSDNPATVLLPALRHLLPSLPGVAGDIALPGAAEVGYDRVPLHAAWSLARLWKEARAGMP
SVTQPVLLMHSPQDHVVSPRNSAMVLARISSTDVTELLLDRSFHVATLDHDAGLIFGASL
DFVRRLAPAAAVDAGTHHSG
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgccgctgctgccgggtgccgagccgttccgccgctcgggcggtccggtcggcgtgctg
ctggtccacggtttcaccggttcgccgcagtccatgcgcccctgggccgaacacctcgcc
gacgccggcctgacggtctccgccccgctgctgccgggccacggcacccgctggcaggac
ctccagccgacccgctgggaggactggtacgcgaccgcggaggccgcgttcgaggagctg
gccgccgagtgcgcgcaggtcttcgtctgcgcgctgtcgatgggcgggtcgctggccctg
cggctggccgcgaagcacggcggacgggtctccggactggtgctcgtcaacccctcggtg
cgttccgacaaccccgcgacggtgcttcttccggcgctgcgccacctgctgccctcgctg
cccggcgtggccggcgacatcgccctgccgggcgcggccgaggtcggctacgaccgggtg
ccgctgcacgccgcctggtcgctggcccggctgtggaaggaggcccgggcgggaatgccg
tcggtgacccagccggttctgctgatgcacagtccgcaggaccacgtcgtctcgccgcgc
aactcggccatggtgctcgcccggatatcctcgaccgatgtgacggagctgctgctcgac
cgcagcttccacgtggccacgctggaccacgacgccggtctgatcttcggggcgagcctc
gacttcgtccggcgactggccccggcagcggcggtcgatgccgggacccaccactcgggc
tga

DBGET integrated database retrieval system