KEGG   Kitasatospora setae: KSE_22170Help
Entry
KSE_22170         CDS       T01648                                 

Gene name
sucB
Definition
(GenBank) putative dihydrolipoyllysine-residue succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ksk  Kitasatospora setae
Pathway
ksk00020  Citrate cycle (TCA cycle)
ksk00310  Lysine degradation
ksk01100  Metabolic pathways
ksk01110  Biosynthesis of secondary metabolites
ksk01120  Microbial metabolism in diverse environments
ksk01130  Biosynthesis of antibiotics
ksk01200  Carbon metabolism
Module
ksk_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ksk_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ksk00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    KSE_22170 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    KSE_22170 (sucB)
Enzymes [BR:ksk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     KSE_22170 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H HlyD_3
Motif
Other DBs
NCBI-ProteinID: BAJ28039
NITE: KSE_22170
UniProt: E4NA08
Position
2460647..2462413
Genome map
AA seq 588 aa AA seqDB search
MAVSVTLPALGESVTEGTVTRWLKAEGERVEIDEPLLEVSTDKVDTEIPAPASGILASIK
VGEDETVEVGAELAIIDDGSGAPAAAPAPAAEAAPAPAAAPAAPVEEAPAAPAPAAAPAA
AAPAGDATPVLLPALGESVTEGTVTRWLKAEGDTVEVDEPLLEVSTDKVDTEIPSPVAGT
LVKILVGEDETAEVGAQLALIGAAGAVAAAPAAPAPVAAPAAPAAPAPVAAAPAAAPAPV
AAPAAPAPVAPAPAAPAAAPAPVAAAPVAAAPAAPVADSGDAYVTPLVRKLAAEHGVALG
SVAGTGVGGRIRKQDVIAAAEAAKAAPAPAAAPAAAPAAPAKAAAAPSALRGQTVKMTRM
RKVIGDNMLKALHEQAQLTSVVEVDVTRIIALRAKAKDSFLAREGVKLSPMPFFVKAAAQ
ALKAHAVINARINEAEGTITYFDTENIGIAVDSEKGLMTPVIKGAGDLNIAGISKKTAEL
ASKVRGNKITPDELSGATFTISNTGSRGALFDTVIVPPNQVAILGIGATVKRPVVIEADG
GTAIGIRDMTYLSLSYDHRLVDGADAARYLVAVKEILEAGEFEVELGL
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atggcggtctcagtaacactgcccgcgctgggcgagagcgtgaccgaaggcaccgtcacc
cgctggctgaaggccgagggtgagcgcgtggagatcgacgagccgctgctcgaggtctcc
accgacaaggtcgacaccgagatcccggcgccggcctccggcatcctggcctcgatcaag
gtcggcgaggacgagaccgtcgaggtcggcgccgagctggcgatcatcgacgacggctcc
ggcgcccccgccgccgccccggcccccgccgccgaggccgctccggccccggccgccgcc
ccggccgccccggtcgaggaggcccccgcggcccccgcgccggccgccgctccggccgcc
gccgcccccgcgggcgacgccaccccggtgctgctgcccgcgctgggcgagtcggtcacc
gagggcaccgtcacccgctggctgaaggccgagggcgacaccgtcgaggtcgacgagccg
ctgctcgaggtctccaccgacaaggtcgacaccgagatcccctcccccgtggcgggcacc
ctggtgaagatcctggtcggcgaggacgagaccgccgaggtcggcgcccagctcgcgctg
atcggcgccgcgggcgcggtcgccgccgccccggctgctccggctccggttgccgccccg
gccgccccggctgctccggctccggttgccgccgctccggccgccgccccggccccggtt
gccgctccggctgccccggccccggttgccccggccccggccgctccggccgccgccccg
gctccggtcgccgctgccccggtcgccgccgctccggccgcgccggtcgcggactccggt
gacgcctacgtcaccccgctggtgcgcaagctcgccgccgagcacggcgtcgcgctcggc
tccgtcgccggcaccggcgtcggcggccgtatccgcaagcaggacgtgatcgccgccgcc
gaggccgccaaggccgcgccggctccggccgccgcccccgccgccgctccggccgccccg
gcgaaggcggccgccgcgccgtccgcgctgcgcggccagaccgtcaagatgacccgcatg
cgcaaggtcatcggcgacaacatgctgaaggccctgcacgagcaggcccagctgaccagc
gtggtcgaggtggacgtcacccggatcatcgcgctgcgcgcgaaggcgaaggactccttc
ctggcccgcgagggcgtgaagctgtccccgatgccgttcttcgtgaaggccgccgcccag
gcgctgaaggcccacgcggtcatcaacgcccggatcaacgaggccgagggcaccatcacc
tacttcgacaccgagaacatcggcatcgcggtggactccgagaagggcctgatgaccccg
gtcatcaagggcgcgggcgacctcaacatcgccggcatctcgaagaagaccgcggagctg
gcctcgaaggtccgcggcaacaagatcaccccggacgagctgtccggcgcgaccttcacc
atctccaacaccggttcgcgcggtgcgctgttcgacaccgtcatcgtcccgccgaaccag
gtcgccatcctgggcatcggcgcgaccgtgaagcgcccggtggtcatcgaggcggacggc
ggcaccgccatcggcatccgcgacatgacctacctgtcgctctcctacgaccaccgcctg
gtggacggcgccgacgccgcccgctacctggtcgcggtcaaggagatcctggaggccggc
gagttcgaggtcgagctcggcctgtaa

DBGET integrated database retrieval system