KEGG   Kitasatospora setae: KSE_22170Help
Entry
KSE_22170         CDS       T01648                                 

Gene name
sucB
Definition
putative dihydrolipoyllysine-residue succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ksk  Kitasatospora setae
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ksk00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    KSE_22170 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    KSE_22170 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    KSE_22170 (sucB)
Enzymes [BR:ksk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     KSE_22170 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
2460647..2462413
Genome map
AA seq 588 aa AA seqDB search
MAVSVTLPALGESVTEGTVTRWLKAEGERVEIDEPLLEVSTDKVDTEIPAPASGILASIK
VGEDETVEVGAELAIIDDGSGAPAAAPAPAAEAAPAPAAAPAAPVEEAPAAPAPAAAPAA
AAPAGDATPVLLPALGESVTEGTVTRWLKAEGDTVEVDEPLLEVSTDKVDTEIPSPVAGT
LVKILVGEDETAEVGAQLALIGAAGAVAAAPAAPAPVAAPAAPAAPAPVAAAPAAAPAPV
AAPAAPAPVAPAPAAPAAAPAPVAAAPVAAAPAAPVADSGDAYVTPLVRKLAAEHGVALG
SVAGTGVGGRIRKQDVIAAAEAAKAAPAPAAAPAAAPAAPAKAAAAPSALRGQTVKMTRM
RKVIGDNMLKALHEQAQLTSVVEVDVTRIIALRAKAKDSFLAREGVKLSPMPFFVKAAAQ
ALKAHAVINARINEAEGTITYFDTENIGIAVDSEKGLMTPVIKGAGDLNIAGISKKTAEL
ASKVRGNKITPDELSGATFTISNTGSRGALFDTVIVPPNQVAILGIGATVKRPVVIEADG
GTAIGIRDMTYLSLSYDHRLVDGADAARYLVAVKEILEAGEFEVELGL
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atggcggtctcagtaacactgcccgcgctgggcgagagcgtgaccgaaggcaccgtcacc
cgctggctgaaggccgagggtgagcgcgtggagatcgacgagccgctgctcgaggtctcc
accgacaaggtcgacaccgagatcccggcgccggcctccggcatcctggcctcgatcaag
gtcggcgaggacgagaccgtcgaggtcggcgccgagctggcgatcatcgacgacggctcc
ggcgcccccgccgccgccccggcccccgccgccgaggccgctccggccccggccgccgcc
ccggccgccccggtcgaggaggcccccgcggcccccgcgccggccgccgctccggccgcc
gccgcccccgcgggcgacgccaccccggtgctgctgcccgcgctgggcgagtcggtcacc
gagggcaccgtcacccgctggctgaaggccgagggcgacaccgtcgaggtcgacgagccg
ctgctcgaggtctccaccgacaaggtcgacaccgagatcccctcccccgtggcgggcacc
ctggtgaagatcctggtcggcgaggacgagaccgccgaggtcggcgcccagctcgcgctg
atcggcgccgcgggcgcggtcgccgccgccccggctgctccggctccggttgccgccccg
gccgccccggctgctccggctccggttgccgccgctccggccgccgccccggccccggtt
gccgctccggctgccccggccccggttgccccggccccggccgctccggccgccgccccg
gctccggtcgccgctgccccggtcgccgccgctccggccgcgccggtcgcggactccggt
gacgcctacgtcaccccgctggtgcgcaagctcgccgccgagcacggcgtcgcgctcggc
tccgtcgccggcaccggcgtcggcggccgtatccgcaagcaggacgtgatcgccgccgcc
gaggccgccaaggccgcgccggctccggccgccgcccccgccgccgctccggccgccccg
gcgaaggcggccgccgcgccgtccgcgctgcgcggccagaccgtcaagatgacccgcatg
cgcaaggtcatcggcgacaacatgctgaaggccctgcacgagcaggcccagctgaccagc
gtggtcgaggtggacgtcacccggatcatcgcgctgcgcgcgaaggcgaaggactccttc
ctggcccgcgagggcgtgaagctgtccccgatgccgttcttcgtgaaggccgccgcccag
gcgctgaaggcccacgcggtcatcaacgcccggatcaacgaggccgagggcaccatcacc
tacttcgacaccgagaacatcggcatcgcggtggactccgagaagggcctgatgaccccg
gtcatcaagggcgcgggcgacctcaacatcgccggcatctcgaagaagaccgcggagctg
gcctcgaaggtccgcggcaacaagatcaccccggacgagctgtccggcgcgaccttcacc
atctccaacaccggttcgcgcggtgcgctgttcgacaccgtcatcgtcccgccgaaccag
gtcgccatcctgggcatcggcgcgaccgtgaagcgcccggtggtcatcgaggcggacggc
ggcaccgccatcggcatccgcgacatgacctacctgtcgctctcctacgaccaccgcctg
gtggacggcgccgacgccgcccgctacctggtcgcggtcaaggagatcctggaggccggc
gagttcgaggtcgagctcggcctgtaa

DBGET integrated database retrieval system