KEGG   Kitasatospora setae: KSE_22240Help
Entry
KSE_22240         CDS       T01648                                 

Gene name
bdh
Definition
putative 3-hydroxybutyrate dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
ksk  Kitasatospora setae
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:ksk00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:ksk00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
2469152..2469925
Genome map
AA seq 257 aa AA seqDB search
MDTTSAPPSGPPLSGRTALVTGAASGIGRACAEAFAAAGAHVYVVDLAGAAAEELAAAIG
GTAHVADLSDPEAVEALPADADIVVNNAGLQHVAPVHEFPVERFTLIQRVMVEAPFRILR
RTLPHMYGRGWGRVVNISSVHGLRASAFKSAYVTAKHALEGLSKTVALEGAPYGVTSNCV
NPAYVRTPLVERQIAAQALAHGIREDEVVERILLDRTAVKRLIEPDEVARLALWLCSPGA
SYVTGASLPVDGGWTAH
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atggacaccacttctgccccgccctccggccccccgctgtcgggccgcaccgcgctggtc
accggagccgcctccggcatcggccgggcctgcgcggaggcgttcgccgcggcgggcgcg
cacgtgtacgtcgtcgacctggccggcgccgcggccgaggagctggcggccgcgatcggc
ggcaccgcgcacgtcgcggacctgtcggacccggaggcggtggaggcgctgccggccgac
gcggacatcgtggtcaacaacgccggcctgcagcacgtcgccccggtgcacgagttcccg
gtggagcggttcacgctgatccagcgggtgatggtggaggccccgttccggatcctgcgc
cgcaccctgccgcacatgtacgggcgcgggtggggccgggtggtcaacatctcctcggtg
cacggcctgcgcgccagcgccttcaagtcggcgtacgtgacggccaagcacgccctggag
ggcctgagcaagaccgtcgccctggagggcgccccgtacggcgtgaccagcaactgcgtg
aacccggcgtacgtgcgcaccccgctggtggagcggcagatcgccgcgcaggcgctggcg
cacggcatccgcgaggacgaggtggtggagcggatcctgctggaccggaccgccgtgaag
cggctgatcgagccggacgaggtggcccggctggcgctgtggctgtgctcgccgggcgcc
tcgtacgtgaccggcgcgagcctgccggtggacggcggctggaccgcgcactga

DBGET integrated database retrieval system