KEGG   Kitasatospora setae: KSE_22240Help
Entry
KSE_22240         CDS       T01648                                 

Gene name
bdh
Definition
putative 3-hydroxybutyrate dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
ksk  Kitasatospora setae
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ksk00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    KSE_22240 (bdh)
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    KSE_22240 (bdh)
Enzymes [BR:ksk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     KSE_22240 (bdh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
2469152..2469925
Genome map
AA seq 257 aa AA seqDB search
MDTTSAPPSGPPLSGRTALVTGAASGIGRACAEAFAAAGAHVYVVDLAGAAAEELAAAIG
GTAHVADLSDPEAVEALPADADIVVNNAGLQHVAPVHEFPVERFTLIQRVMVEAPFRILR
RTLPHMYGRGWGRVVNISSVHGLRASAFKSAYVTAKHALEGLSKTVALEGAPYGVTSNCV
NPAYVRTPLVERQIAAQALAHGIREDEVVERILLDRTAVKRLIEPDEVARLALWLCSPGA
SYVTGASLPVDGGWTAH
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atggacaccacttctgccccgccctccggccccccgctgtcgggccgcaccgcgctggtc
accggagccgcctccggcatcggccgggcctgcgcggaggcgttcgccgcggcgggcgcg
cacgtgtacgtcgtcgacctggccggcgccgcggccgaggagctggcggccgcgatcggc
ggcaccgcgcacgtcgcggacctgtcggacccggaggcggtggaggcgctgccggccgac
gcggacatcgtggtcaacaacgccggcctgcagcacgtcgccccggtgcacgagttcccg
gtggagcggttcacgctgatccagcgggtgatggtggaggccccgttccggatcctgcgc
cgcaccctgccgcacatgtacgggcgcgggtggggccgggtggtcaacatctcctcggtg
cacggcctgcgcgccagcgccttcaagtcggcgtacgtgacggccaagcacgccctggag
ggcctgagcaagaccgtcgccctggagggcgccccgtacggcgtgaccagcaactgcgtg
aacccggcgtacgtgcgcaccccgctggtggagcggcagatcgccgcgcaggcgctggcg
cacggcatccgcgaggacgaggtggtggagcggatcctgctggaccggaccgccgtgaag
cggctgatcgagccggacgaggtggcccggctggcgctgtggctgtgctcgccgggcgcc
tcgtacgtgaccggcgcgagcctgccggtggacggcggctggaccgcgcactga

  All links  
No link information was found.   
DBGET integrated database retrieval system