KEGG   Kitasatospora setae: KSE_23240Help
Entry
KSE_23240         CDS       T01648                                 

Definition
putative alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
ksk  Kitasatospora setae
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ksk00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    KSE_23240
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KSE_23240
  Lipid metabolism
   00071 Fatty acid degradation
    KSE_23240
  Amino acid metabolism
   00350 Tyrosine metabolism
    KSE_23240
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    KSE_23240
   00626 Naphthalene degradation
    KSE_23240
Enzymes [BR:ksk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     KSE_23240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(2577501..2578541)
Genome map
AA seq 346 aa AA seqDB search
MKAVQYRTVGGHPEVVTVPDPEPGPGQVLLKVTAAGVCHSDIAVMSWPAEQLPFPLPLTL
GHEGVGTVASLGAGVTGLTEGESVAVYGPWGCGACAKCAEGKENYCLRAAELGIMPPGLG
APGAMAEYMVVDDPRHLVPLGDLDPVRTVPLTDAGLTPYHAIKRSLPKLVPGSTAVVIGT
GGLGHVAIQLLRAMTAARVIALDVTEEKLALARTVGAHEAVLSDGAAAGHVRELTAGLGA
QAVFDFVGAPPTTALAGQLAAVEGDVTIVGIGGGTLAVGFGALPYEVSVTSPYWGSRAEL
IEVLDLARAGAVDVHVETYGIDEAPLAYERLHAGKINGRAVILPNG
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcagtccagtaccgcaccgtcggcggccaccccgaggtggtcaccgtccccgat
cccgaacccggccccgggcaggtcctgctgaaggtcaccgccgcgggcgtctgccactcc
gacatcgccgtgatgagctggccggccgagcagttgccgttcccgctcccgctcaccctc
gggcacgagggcgtcggcaccgtcgcctcgctcggcgcgggcgtcaccggcctcaccgag
ggcgagtcggtcgccgtgtacggcccgtggggctgcggcgcctgcgccaagtgcgccgag
ggcaaggagaactactgcctgcgcgccgccgaactcggcatcatgccgcccgggctgggc
gcgcccggagcgatggccgagtacatggtcgtcgacgacccgcggcacctcgtcccgctc
ggcgacctcgacccggtgcgcaccgtcccgctcaccgacgccgggctgaccccgtaccac
gcgatcaagcgctcgctgcccaagctcgtgcccggctccaccgcggtcgtcatcggcacc
ggcggcctcggacacgtcgcgatccagctgctgcgcgcgatgaccgcggcccgggtgatc
gccctcgacgtcaccgaggagaagctcgcgctggcccgcaccgtcggcgcccacgaggcg
gtcctctcggacggcgcggcggctggccacgtccgcgaactcaccgccggactcggcgcg
caggccgtcttcgacttcgtcggcgccccgcccaccaccgccctggccggacagctcgcc
gccgtcgagggcgacgtcaccatcgtcggcatcggcggcggcaccctggcggtcggcttc
ggcgccctgccgtacgaggtctccgtcacctccccgtactggggcagtcgcgccgagctg
atcgaggtcctcgacctggcccgggccggcgcggtcgacgtgcacgtcgagacgtacggc
atcgacgaggcgccgctggcctacgagcggctgcacgccgggaagatcaacgggcgggcg
gtgatcctgccgaacggctga

DBGET integrated database retrieval system