KEGG   Kitasatospora setae: KSE_23720Help
Entry
KSE_23720         CDS       T01648                                 

Definition
(GenBank) putative acetaldehyde dehydrogenase
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
ksk  Kitasatospora setae
Pathway
ksk00360  Phenylalanine metabolism
ksk00362  Benzoate degradation
ksk00620  Pyruvate metabolism
ksk00621  Dioxin degradation
ksk00622  Xylene degradation
ksk00650  Butanoate metabolism
ksk01100  Metabolic pathways
ksk01120  Microbial metabolism in diverse environments
ksk01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ksk00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    KSE_23720
   00650 Butanoate metabolism
    KSE_23720
  Amino acid metabolism
   00360 Phenylalanine metabolism
    KSE_23720
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    KSE_23720
   00622 Xylene degradation
    KSE_23720
   00621 Dioxin degradation
    KSE_23720
Enzymes [BR:ksk01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     KSE_23720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: BAJ28190
NITE: KSE_23720
UniProt: E4NAF9
Position
complement(2639901..2640788)
Genome map
AA seq 295 aa AA seqDB search
MSTTTPLKVAVLGAGLIGIDLLHKIDRSPSLDCVLVVGRDSQNTGLRQAAAMGLATTAGG
AAALLDSGQHVDLVFDASNADSHAEHWRLLEPTGALVVDLTPHNSGIPTVPTVNAAEALT
SRHLSLISCGGQAAVPLLHAIARHRTPEYVEVVSTGASRSAGRATRLNLDEYIATTQGAI
RAFTGAPEVKVLVNVSPATPPPPFRVTLTVLASDIDPGTVRNLVATTSHEVSAFAPGYAV
TSIDAASEKVIVAVEVTAVGGRIPAYAGNLDIINAAAINLAEMHAASVLAEGAAA
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgtccacgaccaccccgctgaaggtcgccgtcctcggtgccggcctcatcggcatcgac
ctgctgcacaagatcgaccggtctccgtctctcgactgtgtgctggtcgtcggccgcgac
agccagaacaccggactccggcaggccgccgcgatgggccttgccacgacagccggcggt
gccgccgcgctgctggactccggccagcacgtcgacctcgtcttcgacgcctccaacgcc
gactcccacgccgagcactggcggctgctggagcccaccggcgccctggtcgtcgacctc
acaccgcacaacagcggcatccccacggtgccgacggtcaatgccgccgaagcactgacc
agccgtcacctcagcctgatcagctgcggcggccaggccgccgtccccctcctgcacgcc
atagcccgacaccgcacgcccgagtacgtcgaggtggtctccaccggggccagccgcagc
gccggccgggcgacccgcctgaacctggacgaatacatcgccaccacccaaggcgccatc
cgcgcgttcaccggcgcccccgaagtgaaggtgctggtcaacgtcagccccgccaccccg
ccgccgcccttccgcgtcaccctgaccgtcctggcctccgacatcgacccgggcacggtg
cgaaacctggtcgccaccacctcccacgaagtcagtgcgttcgcccccggctacgcggtg
acctccatcgacgcggccagcgagaaggtcatcgtcgccgtcgaggtcaccgcagttggc
ggacgcatccccgcctacgcgggcaacctcgacatcatcaacgcagccgcgatcaatctg
gccgagatgcacgccgcctccgtactcgccgaaggagccgcggcatga

DBGET integrated database retrieval system