KEGG   Kitasatospora setae: KSE_27680Help
Entry
KSE_27680         CDS       T01648                                 

Gene name
adhE
Definition
putative aldehyde dehydrogenase/alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
ksk  Kitasatospora setae
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ksk00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    KSE_27680 (adhE)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KSE_27680 (adhE)
   00620 Pyruvate metabolism
    KSE_27680 (adhE)
   00650 Butanoate metabolism
    KSE_27680 (adhE)
  Lipid metabolism
   00071 Fatty acid degradation
    KSE_27680 (adhE)
  Amino acid metabolism
   00350 Tyrosine metabolism
    KSE_27680 (adhE)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    KSE_27680 (adhE)
   00626 Naphthalene degradation
    KSE_27680 (adhE)
Enzymes [BR:ksk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     KSE_27680 (adhE)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     KSE_27680 (adhE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
3101070..3103769
Genome map
AA seq 899 aa AA seqDB search
MSSREKTPAETPAAPAAPAAPAAPAADPAAVEAAEAAAAVDVLVRNGRKALREYAGFTQE
KVDRIVKKASLAALAAHTRLAALAVEETGRGVFEDKAVKNVFACENVTHSMAGMKTVGVV
SRDEIDGITEIAEPVGVVAGVTPVTNPTSTTIFKALIALKTRNPIVFGFHPAAQRCSAEA
ARIVRDAAVAAGAPAHCVQWIERPSMAATGALMRHEDVATILATGGNGMVRAAYSCGKPA
LGVGAGNVPAYVEKSADLKRAVNDIVLSKSFDNGMICASEQAVILDAEVYGPALAEFRKL
KAHLASAEEKAKLEAYVFGVGEDRNCAGAKLNAAVVGRSAPEIAAAAGFEVPADTSVILA
EVGGVGEAEPLTREKLCPVLAVLRADSRAHGLELATGMVEFNGLGHSAAVHSEDAAFVEE
FGTAVKACRIIWNAPSSQGGIGDVYNAFLPSLTLGCGSYGHNSVSGNVSALNLVNIKRIG
RRNTNMQWFKVPPKVFFERNSIRYLADMRGARKVVVVTDKTMVEIGHLDRIREVLSRRTE
PVEVRVVDFVEPNPSIATVEKGAELMRGFQPDTIVALGGGSPMDAAKVMWLMYEHPEVEF
ADLKEKFFDIRKRAFTFPDLGEKAKLVCIPTTSGTGSEVTPFAVITDPESGQKYPLADYA
LTPTVAIVDPALTTHLPREVTADSGFDALTHCVETYVSVYANDFTDGLALQGIRLIFENL
EAAVVDGPDAPVAREKMHNAGTIAGMAFGSAFLGVVHAMAHTLGATFHVAHGRTNALLLP
HVIRYNGSAPAKVTSWPKYQSYVAPERYQQIARMLGLPAATPEQGVESLAAAVEELRDRV
GIPRSFKDAGVDEAAFLAALPQQAMSAYEDQCAPANPRMPMLADMRQLMTQAYYGDRAV
NT seq 2700 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcccgcgagaagacccccgccgagacccccgccgcccccgccgcccccgccgcc
cccgccgcccccgctgccgatcccgccgccgtcgaggcggccgaggcggcggccgccgtc
gacgtgctggtccgcaacggccgcaaggcgctgcgcgagtacgccggtttcacccaggag
aaggtggaccggatcgtgaagaaggcgtcgctggcggcgctggcggcgcacacccggctg
gcggcgctggcggtcgaggagaccgggcgcggcgtgttcgaggacaaggcggtgaagaac
gtcttcgcctgcgagaacgtgacgcactcgatggcggggatgaagaccgtcggcgtggtc
tcccgcgacgagatcgacgggatcaccgagatcgccgagccggtgggcgtggtcgcgggc
gtgacgccggtgaccaacccgacctcgacgacgatcttcaaggcgctgatcgcgctgaag
acccgcaacccgatcgtcttcggcttccacccggcggcgcagcgctgctccgcggaggcg
gcccggatcgtccgggacgcggcggtcgcggcgggcgccccggcgcactgcgtgcagtgg
atcgagcggccgtcgatggcggcgaccggtgcgctgatgcggcacgaggacgtggcgacg
atcctggcgaccggcggcaacggcatggtgcgggcggcgtactcgtgcgggaagccggcg
ctgggcgtcggcgcgggcaacgtgccggcgtacgtggagaagagcgcggacctgaagcgc
gcggtgaacgacatcgtgctgtcgaagtccttcgacaacgggatgatctgcgcgtccgag
caggcggtgatcctggacgccgaggtgtacggtccggcgctggccgagttccggaagctg
aaggcgcacctggcgtcggcggaggagaaggcgaagctggaggcgtacgtcttcggggtc
ggcgaggaccggaactgcgcgggcgcgaagctgaacgcggcggtggtggggcggtcggcg
ccggagatcgcggcggcggcgggcttcgaggtgccggccgacacctcggtcatcctggcg
gaggtcggcggggtgggcgaggccgagccgctgacccgggagaagctctgcccggtgctg
gcggtgctgcgggcggacagccgggcgcacggcctggagctggcgaccgggatggtggag
ttcaacggcctggggcactcggcggcggtgcacagcgaggacgcggcgttcgtcgaggag
ttcggcaccgcggtgaaggcgtgccggatcatctggaacgcgccgagttcgcagggcggc
atcggcgacgtctacaacgcgttcctgccgtcgctgacgctgggctgcggcagttacggg
cacaactcggtgtcggggaacgtctcggcgctgaacctggtcaacatcaagcggatcggg
cggcgcaacaccaacatgcagtggttcaaggtgccgccgaaggtcttcttcgagcgcaac
tcgatcaggtacctggccgacatgcggggcgcccgcaaggtcgtcgtggtcaccgacaag
acgatggtggagatcgggcacctggaccggatccgggaggtgctgtcccggcgcaccgag
ccggtggaggtgcgggtggtggacttcgtggagccgaacccgagcatcgcgaccgtggag
aagggcgccgagctgatgcgcggcttccagccggacaccatcgtggcgctgggcggcggt
tcgccgatggacgcggcgaaggtgatgtggctgatgtacgagcacccggaggtcgagttc
gcggacctgaaggagaagttcttcgacatccgcaagcgcgccttcaccttccccgacctg
ggcgagaaggccaagctggtgtgcatcccgaccacgtcgggcaccggcagcgaggtgacg
ccgttcgcggtgatcaccgacccggagagcggccagaagtacccgctggcggactacgcg
ctgaccccgacggtggcgatcgtcgacccggcgctgaccacgcacctgccgagggaggtg
acggcggactccggcttcgacgcgctgacgcactgcgtcgagacgtacgtgtcggtgtac
gccaacgacttcaccgacgggctggcgctgcagggcatccggctgatcttcgagaacctg
gaggcggcggtcgtcgacgggccggacgcgccggtggcccgggagaagatgcacaacgcg
ggcacgatcgcgggcatggcgttcggctcggccttcctgggcgtggtgcacgcgatggcg
cacaccctgggcgcgaccttccacgtggcgcacgggcggaccaacgcgctgctgctgccg
cacgtgatccgctacaacgggtcggcgccggccaaggtgaccagctggccgaagtaccag
agctacgtggcgccggagcgctaccagcagatcgcccggatgctgggcctgccggccgcg
accccggagcagggcgtggagtcgctggccgcggcggtcgaggagctgcgcgaccgggtg
ggcatcccgcgctcgttcaaggacgccggggtggacgaggcggccttcctggcggcgctg
ccgcagcaggcgatgtccgcgtacgaggaccagtgcgcgccggccaacccgcggatgccg
atgctggcggacatgcggcagttgatgacccaggcgtactacggcgaccgggcggtgtga

DBGET integrated database retrieval system