KEGG   Kitasatospora setae: KSE_28330Help
Entry
KSE_28330         CDS       T01648                                 

Gene name
pncA
Definition
putative pyrazinamidase/nicotinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
ksk  Kitasatospora setae
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ksk00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    KSE_28330 (pncA)
Enzymes [BR:ksk01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     KSE_28330 (pncA)
    3.5.1.-  
     KSE_28330 (pncA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
3173215..3173805
Genome map
AA seq 196 aa AA seqDB search
MHRALIVVDVQNDFCEGGSLPVAGGAEVAAAITDLIAESAPGYAHIVATRDHHIDPGPHF
AAEPDYARSWPAHCVAGTEGVGFHPNFAPSVTSGAVEAVFSKGAHAAAYSGFEGFDEHGG
TLADWLNERGVTDVDVVGIATDHCVRATALDAAREGFATRVLLDLTAGVAAATTATALDE
LRSAGVELTGTPVVRS
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgcaccgggccctgatcgtcgtcgacgtgcagaacgacttctgcgagggcggcagcctc
cccgtcgccggcggggccgaggtcgcggccgcgatcaccgacctgatcgccgagtccgcc
cccggctacgcccacatcgtcgccacccgcgaccaccacatcgaccccggaccgcacttc
gccgccgagccggactacgcgcgctcctggcccgcgcactgcgtggccggcaccgagggc
gtgggcttccaccccaacttcgccccctcggtgacctccggcgcggtcgaggcggtgttc
tccaagggcgcgcacgccgccgcgtacagtggcttcgagggcttcgacgagcacggcggc
accctcgccgactggctgaacgagcgcggcgtcaccgacgtcgacgtggtcggcatcgcc
accgaccactgcgtccgcgccaccgccctggacgccgcccgcgagggcttcgccacccgg
gtcctgctcgacctcacggccggcgtcgccgccgccaccaccgccaccgcgctggacgaa
ctgcgctcggcgggcgtcgagttgaccggaactccggtcgtccgaagctga

  All links  
No link information was found.   
DBGET integrated database retrieval system