KEGG   Kitasatospora setae: KSE_28760Help
Entry
KSE_28760         CDS       T01648                                 

Definition
putative beta-N-acetylhexosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
ksk  Kitasatospora setae
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ksk00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    KSE_28760
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    KSE_28760
Enzymes [BR:ksk01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     KSE_28760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(3221926..3223563)
Genome map
AA seq 545 aa AA seqDB search
MDLIPAPSHVQAGPDAPPFVLHAGSRIAAAPGTAAAARRLRAELSAATGFDLDPAPAGQD
GDLRLDLDPALGAEEYRLSADAESVRLTAGGPAGLGHAVQTLRQLLGPAAYRTAPLPGAS
WTVPAVEIRDAPRFGWRGAMLDVSRHFMPKAGVLRFVDQLAAHKLNVLHFHLTDDQGWRF
EVKRYPRLTEVGGWRERSMVGYRAGNRRDDQPHGGYYTQDDLREIVAYAAARGVTVVPEI
DLPGHNQAAVAAYPELGNTDVVDTAALGTWTDWGVSENILNPSEATLRFYEHVLEELLEV
FPSTFVHLGGDECPKDQWKQSPAAQARIAELGLKDEFELQSHVIRHFDGWLAARGRRLIG
WDEILEGGLAPGAAVSSWRGYDGGIAAANAGHDVVMCPEQHVYLDHRQADGDDEPIPVGW
VRTLEDVYRFEPVPPQLDEAAAAHVIGTQANLWTEFMYSGRDVDYKAFPRLAALAEVAWS
DLPRDPAARDWAGFERRMATHYLRLEALGVEYRHPDGPRPWQRKPGIVGRPLAGKPGPSG
EGTAP
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atggacctcatccctgccccgtcgcacgtccaggccggccccgacgccccgcccttcgtc
ctgcacgccggctcccggatcgccgccgcccccggcactgcggccgccgcccgccggctg
cgcgccgagctctccgccgccaccggcttcgacctcgacccggccccggccgggcaggac
ggcgacctgcggctcgacctcgacccggcgctcggcgccgaggagtaccggctgagcgcc
gacgcggagtccgtccggctcaccgccggcggccccgccggcctcggccacgccgtgcag
accctgcgccagctgctcggccccgccgcgtaccgcaccgccccgctgcccggcgcgagc
tggacggtgcccgcggtggagatccgcgacgcgccccggttcggctggcgcggcgccatg
ctggacgtctcccggcacttcatgcccaaggccggggtgctgcgcttcgtcgaccagctc
gccgcgcacaagctcaacgtcctgcacttccacctgaccgacgaccagggctggcggttc
gaggtcaagcgctacccgaggctcaccgaggtcggcggctggcgcgagcgctcgatggtc
ggctaccgggccggcaaccggcgcgacgaccagccgcacggcggctactacacccaggac
gacctgcgcgagatcgtcgcctacgcggccgcccggggcgtcaccgtcgtccccgagatc
gacctgcccggccacaaccaggccgccgtcgccgcctaccccgagctcggcaacaccgac
gtggtcgacaccgccgcgctcggcacctggaccgactggggcgtcagcgagaacatcctg
aacccctccgaggcgaccctgcgcttctacgagcacgtgctggaggagctgctggaggtc
ttcccctccaccttcgtgcacctcggcggcgacgagtgccccaaggaccagtggaagcag
tccccggccgcccaggcccggatcgccgaactcggcctgaaggacgagttcgagctgcag
agccacgtcatccggcacttcgacggctggctggccgcccgcggccgccggctgatcggc
tgggacgagatcctggagggcggcctcgcccccggcgccgcggtctcctcctggcgcggc
tacgacggcgggatcgccgccgccaacgccgggcacgacgtggtgatgtgccccgagcag
cacgtctacctcgaccaccggcaggccgacggcgacgacgagccgatcccggtcggctgg
gtgcgcaccctggaggacgtctaccgcttcgagcccgtcccgccgcagctcgacgaggcc
gccgccgcgcacgtcatcggcacccaggccaacctgtggaccgagttcatgtacagcggc
cgggacgtcgactacaaggcgttcccgcggctcgccgcgctcgccgaggtcgcctggtcc
gacctcccgcgcgacccggcggcccgcgactgggccggcttcgagcgccggatggccacc
cactacctgcggctggaggccctcggcgtcgagtaccgccacccggacggcccgcgcccc
tggcagcgcaagcccggcatcgtcggccgcccgctggccgggaagcccggaccgtccggc
gagggcaccgcgccgtga

DBGET integrated database retrieval system