KEGG   Kitasatospora setae: KSE_28790Help
Entry
KSE_28790         CDS       T01648                                 

Gene name
murA1
Definition
(GenBank) putative UDP-N-acetylglucosamine transferase
  KO
K00790  UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
ksk  Kitasatospora setae
Pathway
ksk00520  Amino sugar and nucleotide sugar metabolism
ksk00550  Peptidoglycan biosynthesis
ksk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ksk00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    KSE_28790 (murA1)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    KSE_28790 (murA1)
Enzymes [BR:ksk01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     KSE_28790 (murA1)
Peptidoglycan biosynthesis and degradation proteins [BR:ksk01011]
 Precursor biosynthesis
  Transferase/Dehydrogenase
   KSE_28790 (murA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EPSP_synthase
Motif
Other DBs
NCBI-ProteinID: BAJ28690
NITE: KSE_28790
UniProt: E4NBV9
Position
3224777..3226132
Genome map
AA seq 451 aa AA seqDB search
MTDDVLLVHGGNPLEGEIQIRGAKNLVPKAMVAALLGQGPSRLRNVPDIRDVKVVRGLLQ
LHGVTVRTGDEDGELILDPSHVESANVADIDAHAGSSRIPILFCGPLLHRLGHAFIPGLG
GCDIGGRPVDFHFEVLRQFGATIEKHPQGTYLVATQRLRGTKIELPYPSVGATEQVLLTA
VLAEGVTELRNAAIEPEIVDLICVLQKMGAIISLGTDRTILVTGVDELDGYTHRALPDRL
EAASWACAALATKGDIYVRGAEQIPMMTFLNTFRKVGGAYEIDDEGIRFWHPGGELKAIA
LETDVHPGFQTDWQQPLVVALTQATGLSIVHETVYESRLGFTGALNQMGAHIQLYSECLG
GTPCRFGARNFMHSAVVSGPSKLVGGELVIPDLRGGFSYLIAALAAEGTSTVHGIDLINR
GYENFMDKLRDLGAHIELPAAAEVAEVQLTA
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgacgtcctgctggtccacggcggaaacccgctcgaaggcgagatccagatc
cgcggcgccaagaacctggtccccaaggccatggtcgccgcgctgctcggccagggcccc
agcagactgcgcaacgtcccggacatccgggacgtcaaggtcgtccgcggcctgctgcag
ctgcacggggtcaccgtccgcaccggcgacgaggacggcgagctgatcctcgacccgtcg
cacgtggagtcggcgaacgtcgccgacatcgacgcgcacgccggctcctcgcggatcccg
atcctgttctgcggcccgctgctgcaccgcctcggccacgcgttcatcccgggcctgggc
ggctgcgacatcggcggccgcccggtcgacttccacttcgaggtgctgcgccagttcggc
gcgaccatcgagaagcacccgcagggcacctacctggtcgccacccagcggctgcgcggc
accaagatcgagctgccgtacccgtcggtcggcgcgaccgagcaggtgctgctgaccgcg
gtgctcgccgagggcgtcaccgagctgcgcaacgccgcgatcgagccggagatcgtcgac
ctgatctgcgtgctgcagaagatgggcgcgatcatctcgctgggcaccgaccgcaccatc
ctggtcaccggcgtggacgagctcgacggctacacccaccgggcgctgccggaccgcctg
gaggcggcctcctgggcgtgcgcggcgctggccaccaagggcgacatctacgtccggggc
gccgagcagatcccgatgatgaccttcctgaacaccttccggaaggtcggcggcgcctac
gagatcgacgacgagggcatccggttctggcacccgggcggcgagctcaaggcgatcgcc
ctggagaccgacgtgcacccgggcttccagaccgactggcagcagccgctggtggtggcc
ctgacccaggccaccggcctgtccatcgtgcacgagacggtgtacgagtcgcggctgggc
ttcaccggcgcgctgaaccagatgggcgcgcacatccagctgtacagcgagtgcctgggc
ggcaccccgtgccggttcggggcgcgcaacttcatgcactccgcggtggtctccggcccg
tccaagctggtcggcggcgagctggtcatccccgacctgcgcggcggcttctcgtacctg
atcgcggcgctggcggccgagggcacctcgacggtgcacggcatcgacctgatcaaccgc
ggctacgagaacttcatggacaagctgcgcgacctgggcgcgcacatcgagctgccggcc
gcggccgaggtggccgaggtccagctgaccgcctga

DBGET integrated database retrieval system