KEGG   Kitasatospora setae: KSE_28790Help
Entry
KSE_28790         CDS       T01648                                 

Gene name
murA1
Definition
putative UDP-N-acetylglucosamine transferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
ksk  Kitasatospora setae
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:ksk00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:ksk00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
3224777..3226132
Genome map
AA seq 451 aa AA seqDB search
MTDDVLLVHGGNPLEGEIQIRGAKNLVPKAMVAALLGQGPSRLRNVPDIRDVKVVRGLLQ
LHGVTVRTGDEDGELILDPSHVESANVADIDAHAGSSRIPILFCGPLLHRLGHAFIPGLG
GCDIGGRPVDFHFEVLRQFGATIEKHPQGTYLVATQRLRGTKIELPYPSVGATEQVLLTA
VLAEGVTELRNAAIEPEIVDLICVLQKMGAIISLGTDRTILVTGVDELDGYTHRALPDRL
EAASWACAALATKGDIYVRGAEQIPMMTFLNTFRKVGGAYEIDDEGIRFWHPGGELKAIA
LETDVHPGFQTDWQQPLVVALTQATGLSIVHETVYESRLGFTGALNQMGAHIQLYSECLG
GTPCRFGARNFMHSAVVSGPSKLVGGELVIPDLRGGFSYLIAALAAEGTSTVHGIDLINR
GYENFMDKLRDLGAHIELPAAAEVAEVQLTA
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgacgtcctgctggtccacggcggaaacccgctcgaaggcgagatccagatc
cgcggcgccaagaacctggtccccaaggccatggtcgccgcgctgctcggccagggcccc
agcagactgcgcaacgtcccggacatccgggacgtcaaggtcgtccgcggcctgctgcag
ctgcacggggtcaccgtccgcaccggcgacgaggacggcgagctgatcctcgacccgtcg
cacgtggagtcggcgaacgtcgccgacatcgacgcgcacgccggctcctcgcggatcccg
atcctgttctgcggcccgctgctgcaccgcctcggccacgcgttcatcccgggcctgggc
ggctgcgacatcggcggccgcccggtcgacttccacttcgaggtgctgcgccagttcggc
gcgaccatcgagaagcacccgcagggcacctacctggtcgccacccagcggctgcgcggc
accaagatcgagctgccgtacccgtcggtcggcgcgaccgagcaggtgctgctgaccgcg
gtgctcgccgagggcgtcaccgagctgcgcaacgccgcgatcgagccggagatcgtcgac
ctgatctgcgtgctgcagaagatgggcgcgatcatctcgctgggcaccgaccgcaccatc
ctggtcaccggcgtggacgagctcgacggctacacccaccgggcgctgccggaccgcctg
gaggcggcctcctgggcgtgcgcggcgctggccaccaagggcgacatctacgtccggggc
gccgagcagatcccgatgatgaccttcctgaacaccttccggaaggtcggcggcgcctac
gagatcgacgacgagggcatccggttctggcacccgggcggcgagctcaaggcgatcgcc
ctggagaccgacgtgcacccgggcttccagaccgactggcagcagccgctggtggtggcc
ctgacccaggccaccggcctgtccatcgtgcacgagacggtgtacgagtcgcggctgggc
ttcaccggcgcgctgaaccagatgggcgcgcacatccagctgtacagcgagtgcctgggc
ggcaccccgtgccggttcggggcgcgcaacttcatgcactccgcggtggtctccggcccg
tccaagctggtcggcggcgagctggtcatccccgacctgcgcggcggcttctcgtacctg
atcgcggcgctggcggccgagggcacctcgacggtgcacggcatcgacctgatcaaccgc
ggctacgagaacttcatggacaagctgcgcgacctgggcgcgcacatcgagctgccggcc
gcggccgaggtggccgaggtccagctgaccgcctga

DBGET integrated database retrieval system