KEGG   Kitasatospora setae: KSE_28830Help
Entry
KSE_28830         CDS       T01648                                 

Definition
(GenBank) putative transcriptional regulator
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
ksk  Kitasatospora setae
Pathway
ksk00860  Porphyrin and chlorophyll metabolism
ksk01100  Metabolic pathways
ksk01110  Biosynthesis of secondary metabolites
ksk01120  Microbial metabolism in diverse environments
Module
ksk_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:ksk00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    KSE_28830
Enzymes [BR:ksk01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     KSE_28830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 Trans_reg_C
Motif
Other DBs
NCBI-ProteinID: BAJ28694
NITE: KSE_28830
UniProt: E4NBW3
Position
complement(3231129..3232289)
Genome map
AA seq 386 aa AA seqDB search
MADPTRRPQDEPEPAEPEPAETGPLAGWTIGVTAARRAEELAALLQRRGAGVLRAPALRI
VPLADDTDLHGATRALIADPPDLAVATTGIGFRGWLEAADGWDLGDGLRAALGRASVLAR
GPKAKGAIRAAGLRESYSAATESSAEVLSHLLEEGVDGLRIAVQLHGAPLPGFVESLRTA
GADVVEVPVYRWLPPADLGPLDRLLDATCAGALDAVTFTSAPAAISLLDRAARRGRTGEL
LHALRRDVLAVCVGPVTSAPLDALDVPTVWPERMRLGAMVQTLTAALPARARRLPVAGHT
LELRGQAALVDGRLRPVPPAGMALLRTLARHPGWVVPRADLLRALPGSGDDEHAVETAMA
RLRQALGAPRLITTVVKRGYRLTLDH
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atggccgacccgacccgacgcccgcaggacgaacccgagcccgccgaacccgagcccgcc
gagaccggcccgctcgccggctggaccatcggcgtcaccgccgcccgccgcgccgaggag
ctcgccgccctgctgcagcgccgcggcgccggcgtgctgcgcgcgcccgcgctgcggatc
gtcccgctcgcggacgacaccgacctgcacggcgccacccgcgccctgatcgccgacccg
cccgacctcgccgtcgccaccaccggcatcggcttccgcggctggctggaggccgccgac
ggctgggacctcggcgacggcctgcgcgccgccctcggccgcgcctcggtgctcgcccgc
ggccccaaggccaagggcgcgatccgggccgccgggctgcgcgagtcctactccgccgcg
accgagtcctccgccgaggtgctctcccacctcctggaggagggcgtcgacggcctgcgg
atcgccgtccagctgcacggcgccccgctgcccggcttcgtcgagtcgctgcgcaccgcc
ggcgccgacgtcgtcgaggtcccggtctaccgctggctcccgcccgccgacctcggcccg
ctcgaccggctgctcgacgcgacctgcgccggcgcgctcgacgccgtcaccttcacctcc
gcgcccgccgcgatcagcctgctcgaccgggccgcccggcgcggccgcaccggggagctg
ctgcacgccctgcgccgcgacgtcctcgcggtctgcgtcggcccggtcacctccgccccg
ctcgacgcgctcgacgtccccaccgtctggcccgagcggatgcggctgggcgcgatggtg
cagaccctcaccgccgccctccccgcccgcgcccgccgcctgccggtggccgggcacacc
ctcgaactgcgcggccaggccgccctggtcgacggccggctgcgccccgtcccgccggcc
ggcatggcgctgctgcgcaccctggcccgccaccccggctgggtcgtgccgcgcgccgac
ctgctccgcgcgctgccgggcagcggcgacgacgagcacgccgtcgagaccgcgatggcc
cggctgcgccaggcactgggcgcaccgcggctgatcaccaccgtcgtcaagcgggggtac
cggctgacgctcgaccactga

DBGET integrated database retrieval system